• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

RAB8B Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6159791

MBS6159791 is an antibody targeting RAB8B. Also known as RAB8B (Ras-related Protein Rab-8B) (PE). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
RAB8B, Monoclonal Antibody
Full Product Name
RAB8B (Ras-related Protein Rab-8B) (PE)
Product Gene Name
anti-RAB8B antibody
Product Synonym Names
FLJ38125
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1E4
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human RAB8B.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
25.7kDa (227aa)
OMIM
613532
3D Structure
ModBase 3D Structure for Q92930
Immunogen
Partial recombinant corresponding to aa101-208 from human RAB8B (NP_057614) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL
Conjugate
PE

Product Categories/Family for anti-RAB8B antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins
Applications Tested/Suitable for anti-RAB8B antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-RAB8B antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-RAB8B antibody

Western Blot detection against Immunogen (37.88kD).
Mouse Anti-RAB8B Monoclonal Antibody – Cat# MBS6159791

Testing Data of anti-RAB8B antibody

Detection limit for recombinant GST tagged RAB8B is 0.03ng/ml as a capture antibody.
Mouse Anti-RAB8B Monoclonal Antibody, Testing Data – Cat# MBS6159791

Other Notes

Small volumes of anti-RAB8B antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for RAB8B. It may not necessarily be applicable to this product.

NCBI GI #
7706563
NCBI GeneID
51762
NCBI Accession #
NP_057614
UniProt Primary Accession #
Q92930
UniProt Secondary Accession #
Q5JPC4; Q9P293
UniProt Related Accession #
Q92930
GenBank Nucleotide #
NM_016530
NCBI Official Full Name
ras-related protein Rab-8B
NCBI Official Synonym Full Names
RAB8B, member RAS oncogene family
NCBI Official Symbol
RAB8B
UniProt Protein Name
Ras-related protein Rab-8B
Protein Family
Ras-related protein
UniProt Gene Name
RAB8B
UniProt Entry Name
RAB8B_HUMAN
NCBI Protein Information
ras-related protein Rab-8B

NCBI Summary for RAB8B

RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles with their target membranes (summary by Chen et al., 1997 [PubMed 9030196]).[supplied by OMIM, Nov 2010]
Show more

UniProt Comments for RAB8B

RAB8B: May be involved in vesicular trafficking and neurotransmitter release. May participate in cell junction dynamics in Sertoli cells. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein; Motility/polarity/chemotaxis; G protein, monomeric; G protein, monomeric, Rab

Chromosomal Location of Human Ortholog: 15q22.2

Cellular Component: peroxisomal membrane; phagocytic vesicle membrane; trans-Golgi network transport vesicle; synaptic vesicle; mitochondrion; perinuclear region of cytoplasm; secretory granule membrane; plasma membrane; phagocytic vesicle; endosome

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding; TPR domain binding; receptor binding

Biological Process: regulation of exocytosis; antigen processing and presentation; synaptic vesicle exocytosis; Golgi vesicle fusion to target membrane; cellular response to insulin stimulus; metabolic process; positive regulation of cell projection organization and biogenesis; protein secretion; cilium biogenesis; protein import into peroxisome membrane; Rab protein signal transduction; vesicle docking during exocytosis; positive regulation of adrenocorticotropic hormone secretion
Show more

Research Articles on RAB8B

1. Rab8A GTPase Ser(111) phosphorylation is not directly regulated by PINK1 in vitro and demonstrate in cells the time course of Ser(111) phosphorylation of Rab8A, 8B and 13 is markedly delayed compared to phosphorylation of Parkin at Ser(65).

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-RAB8B antibody

 Reference Product  PubMed Publications
 RAB3IP antibody  >1 publications with RAB8B and RAB3IP
 OTOF antibody  >1 publications with RAB8B and OTOF

Pathways associated with anti-RAB8B antibody

 Products by Pathway  Pathway Diagram
 Ectoderm Differentiation Pathway antibodies  Ectoderm Differentiation Pathway Diagram
 Membrane Trafficking Pathway antibodies  Membrane Trafficking Pathway Diagram
 Metabolism Of Proteins Pathway antibodies  Metabolism Of Proteins Pathway Diagram
 Post-translational Protein Modification Pathway antibodies  Post-translational Protein Modification Pathway Diagram
 RAB GEFs Exchange GTP For GDP On RABs Pathway antibodies  RAB GEFs Exchange GTP For GDP On RABs Pathway Diagram
 RAB Geranylgeranylation Pathway antibodies  RAB Geranylgeranylation Pathway Diagram
 TBC/RABGAPs Pathway antibodies  TBC/RABGAPs Pathway Diagram
 Tight Junction Pathway antibodies  Tight Junction Pathway Diagram
 Tight Junction Pathway antibodies  Tight Junction Pathway Diagram
 Vesicle-mediated Transport Pathway antibodies  Vesicle-mediated Transport Pathway Diagram

Diseases associated with anti-RAB8B antibody

 Disease Name  Pubmed Publications
 Memory Disorders Antibodies  >1 publications with RAB8B and Memory Disorders
 Hearing Loss Antibodies  >1 publications with RAB8B and Hearing Loss
 Learning Disorders Antibodies  >1 publications with RAB8B and Learning Disorders
 Atrophy Antibodies  >1 publications with RAB8B and Atrophy
 Disease Models, Animal Antibodies  >1 publications with RAB8B and Disease Models, Animal

Organs/Tissues associated with anti-RAB8B antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >23 publications with RAB8B and Brain
 Nerve Antibodies  >8 publications with RAB8B and Nerve
 Kidney Antibodies  >4 publications with RAB8B and Kidney
 Embryonic Tissue Antibodies  >3 publications with RAB8B and Embryonic Tissue
 Spleen Antibodies  >2 publications with RAB8B and Spleen
 Muscle Antibodies  >2 publications with RAB8B and Muscle
 Eye Antibodies  >2 publications with RAB8B and Eye
 Ear Antibodies  >2 publications with RAB8B and Ear
 Testis Antibodies  >2 publications with RAB8B and Testis
 Intestine Antibodies  >1 publications with RAB8B and Intestine
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000