• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

RNF144B Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6159978

MBS6159978 is an antibody targeting RNF144B. Also known as RNF144B (IBRDC2, P53RFP, E3 Ubiquitin-protein Ligase RNF144B, IBR Domain-containing Protein 2, RING Finger Protein 144B, p53-inducible RING Finger Protein) (PE). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
RNF144B, Monoclonal Antibody
Full Product Name
RNF144B (IBRDC2, P53RFP, E3 Ubiquitin-protein Ligase RNF144B, IBR Domain-containing Protein 2, RING Finger Protein 144B, p53-inducible RING Finger Protein) (PE)
Product Gene Name
anti-RNF144B antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F1
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human IBRDC2.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
34kDa
3D Structure
ModBase 3D Structure for Q7Z419
Immunogen
Partial recombinant protein corresponding to aa1-101 from human IBRDC2 (NP_877434) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIFCTACLKQYMQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQF
Conjugate
PE

Product Categories/Family for anti-RNF144B antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger
Applications Tested/Suitable for anti-RNF144B antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-RNF144B antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-RNF144B antibody

IBRDC2 monoclonal antibody Western Blot analysis of IBRDC2 expression in IMR-32.
Mouse Anti-RNF144B Monoclonal Antibody – Cat# MBS6159978

Western Blot (WB) of anti-RNF144B antibody

Western Blot analysis of RNF144B expression in transfected 293T cell line by IBRDC2 monoclonal antibody. Lane 1: RNF144B transfected lysate (33.6kD). Lane 2: Non-transfected lysate.
Mouse Anti-RNF144B Monoclonal Antibody, Western Blot (WB) – Cat# MBS6159978

Immunohistochemistry (IHC) of anti-RNF144B antibody

Immunoperoxidase of monoclonal antibody to IBRDC2 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 1.2ug/ml]
Mouse Anti-RNF144B Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6159978

Immunofluorescence (IF) of anti-RNF144B antibody

Immunofluorescence of monoclonal antibody to IBRDC2 on HeLa cell. [antibody concentration 10ug/ml]
Mouse Anti-RNF144B Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6159978

Other Notes

Small volumes of anti-RNF144B antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for RNF144B. It may not necessarily be applicable to this product.

NCBI GI #
50284696
NCBI GeneID
255488
NCBI Accession #
NP_877434
UniProt Primary Accession #
Q7Z419
UniProt Related Accession #
Q7Z419
GenBank Nucleotide #
NM_182757
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF144B
NCBI Official Synonym Full Names
ring finger protein 144B
NCBI Official Symbol
RNF144B
NCBI Official Synonym Symbols
PIR2; IBRDC2; p53RFP; bA528A10.3
UniProt Protein Name
E3 ubiquitin-protein ligase RNF144B
UniProt Synonym Protein Names
IBR domain-containing protein 2; RING finger protein 144B; p53-inducible RING finger protein
Protein Family
E3 ubiquitin-protein ligase
UniProt Gene Name
RNF144B
UniProt Synonym Gene Names
IBRDC2; P53RFP
UniProt Entry Name
R144B_HUMAN
NCBI Protein Information
E3 ubiquitin-protein ligase RNF144B

UniProt Comments for RNF144B

RNF144B: E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates such as LCMT2, thereby promoting their degradation. Induces apoptosis via a p53/TP53-dependent but caspase-independent mechanism. However, its overexpression also produces a decrease of the ubiquitin-dependent stability of BAX, a pro-apoptotic protein, ultimately leading to protection of cell death; But, it is not an anti-apoptotic protein per se. Belongs to the RBR family. RNF144 subfamily.

Protein type: Membrane protein, integral; Ubiquitin conjugating system; Ubiquitin ligase; EC 6.3.2.-; EC 6.3.2.19; Ligase

Chromosomal Location of Human Ortholog: 6p22.3

Cellular Component: cytoplasm; mitochondrial membrane; integral to membrane; ubiquitin ligase complex

Molecular Function: protein binding; zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: apoptosis; protein ubiquitination during ubiquitin-dependent protein catabolic process
Show more

Research Articles on RNF144B

1. Low RNF144B expression is associated with gastric cancer.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-RNF144B antibody

 Reference Product  PubMed Publications
 UBE2L6 antibody  >1 publications with RNF144B and UBE2L6
 UBE2L3 antibody  >1 publications with RNF144B and UBE2L3
 CDKN1A antibody  >1 publications with RNF144B and CDKN1A

Pathways associated with anti-RNF144B antibody

 Products by Pathway  Pathway Diagram
 Adaptive Immune System Pathway antibodies  Adaptive Immune System Pathway Diagram
 Antigen Processing: Ubiquitination & Proteasome Degradation Pathway antibodies  Antigen Processing: Ubiquitination & Proteasome Degradation Pathway Diagram
 Class I MHC Mediated Antigen Processing & Presentation Pathway antibodies  Class I MHC Mediated Antigen Processing & Presentation Pathway Diagram
 Direct P53 Effectors Pathway antibodies  Direct P53 Effectors Pathway Diagram
 Gastric Cancer Network 2 Pathway antibodies  Gastric Cancer Network 2 Pathway Diagram
 Immune System Pathway antibodies  Immune System Pathway Diagram

Diseases associated with anti-RNF144B antibody

 Disease Name  Pubmed Publications
 Lung Neoplasms Antibodies  >1 publications with RNF144B and Lung Neoplasms
 Pain Antibodies  >1 publications with RNF144B and Pain

Organs/Tissues associated with anti-RNF144B antibody

 Organ/Tissue Name  Pubmed Publications
 Lung Antibodies  >1 publications with RNF144B and Lung
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000