• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Centromere Protein P (CENPP) Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6160016

MBS6160016 is an antibody targeting CENPP. Also known as Centromere Protein P (CENPP, CENP-P, RP11-19J3.3) (PE). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Centromere Protein P (CENPP), Monoclonal Antibody
Full Product Name
Centromere Protein P (CENPP, CENP-P, RP11-19J3.3) (PE)
Product Gene Name
anti-CENPP antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G8
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human RP11-19J3.3.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
35.3 kDa (308aa)
OMIM
611505
3D Structure
ModBase 3D Structure for Q6IPU0
Immunogen
Partial recombinant protein corresponding to aa1-99 from human RP11-19J3.3 (NP_001012267) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRVQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQTEDLTSTEMTEKSI*
Conjugate
PE

Product Categories/Family for anti-CENPP antibody

Antibodies; Centromeres
Applications Tested/Suitable for anti-CENPP antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-CENPP antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-CENPP antibody

Western Blot detection against Immunogen (36.89kD).
Mouse Anti-CENPP Monoclonal Antibody – Cat# MBS6160016

Western Blot (WB) of anti-CENPP antibody

Western Blot analysis of RP11-19J3.3 expression in transfected 293T cell line by RP11-19J3.3 monoclonal antibody. Lane 1: RP11-19J3.3 transfected lysate (33.165kD). Lane 2: Non-transfected lysate.
Mouse Anti-CENPP Monoclonal Antibody, Western Blot (WB) – Cat# MBS6160016

Other Notes

Small volumes of anti-CENPP antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for CENPP. It may not necessarily be applicable to this product.

NCBI GI #
59709758
NCBI GeneID
401541
NCBI Accession #
NP_001012267
UniProt Primary Accession #
Q6IPU0
UniProt Secondary Accession #
Q5T9F8; Q5T9F9; B3KRA5; B3KS17
UniProt Related Accession #
Q6IPU0
GenBank Nucleotide #
NM_001012267
NCBI Official Full Name
centromere protein P isoform a
NCBI Official Synonym Full Names
centromere protein P
NCBI Official Symbol
CENPP
NCBI Official Synonym Symbols
CENP-P
UniProt Protein Name
Centromere protein P
Protein Family
Centromere protein
UniProt Gene Name
CENPP
UniProt Synonym Gene Names
CENP-P
UniProt Entry Name
CENPP_HUMAN
NCBI Protein Information
centromere protein P

NCBI Summary for CENPP

CENPP is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).[supplied by OMIM, Mar 2008]

UniProt Comments for CENPP

CENPP: Component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.

Chromosomal Location of Human Ortholog: 9q22.31

Cellular Component: nucleoplasm; cytosol; chromosome, pericentric region

Biological Process: nucleosome assembly; DNA replication-independent nucleosome assembly at centromere; mitotic cell cycle
Show more

Research Articles on CENPP

1. Data propose that CENP-P/O/R/Q/U self-assembles on kinetochores with varying stoichiometry and undergoes a pre-mitotic maturation step that could be important for kinetochores switching into the correct conformation for microtubule-attachment.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-CENPP antibody

 Products by Pathway  Pathway Diagram
 Cell Cycle Pathway antibodies  Cell Cycle Pathway Diagram
 Cell Cycle, Mitotic Pathway antibodies  Cell Cycle, Mitotic Pathway Diagram
 Chromosome Maintenance Pathway antibodies  Chromosome Maintenance Pathway Diagram
 Deposition Of New CENPA-containing Nucleosomes At The Centromere Pathway antibodies  Deposition Of New CENPA-containing Nucleosomes At The Centromere Pathway Diagram
 M Phase Pathway antibodies  M Phase Pathway Diagram
 Mitotic Anaphase Pathway antibodies  Mitotic Anaphase Pathway Diagram
 Mitotic Metaphase And Anaphase Pathway antibodies  Mitotic Metaphase And Anaphase Pathway Diagram
 Mitotic Prometaphase Pathway antibodies  Mitotic Prometaphase Pathway Diagram
 Nucleosome Assembly Pathway antibodies  Nucleosome Assembly Pathway Diagram
 RHO GTPase Effectors Pathway antibodies  RHO GTPase Effectors Pathway Diagram
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000