• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

DSE Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6160123

DSE is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. This protein is localized to the… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
DSE, Monoclonal Antibody
Full Product Name
DSE (Dermatan-sulfate Epimerase, DS Epimerase, Chondroitin-glucuronate 5-epimerase, Squamous Cell Carcinoma Antigen Recognized by T-cells 2, SART2, SART-2) (PE)
Product Gene Name
anti-DSE antibody
Product Synonym Names
EC=5.1.3.19; dJ323M4; dJ323M4.1; RP3-323M4.1; SH3D6A
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6D4
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human SART2.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
OMIM
605942
3D Structure
ModBase 3D Structure for Q9UL01
Immunogen
Partial recombinant corresponding to aa574-674 from human SART2 (NP_037484) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GEESPLETAASFFHNVDVPFEETVVDGVHGAFIRQRDGLYKMYWMDDTGYSEKATFASVTYPRGYPYNGTNYVNVTMHLRSPITRAAYLFIGPSIDVQS*
Conjugate
PE

Product Categories/Family for anti-DSE antibody

Antibodies; Enzymes
Applications Tested/Suitable for anti-DSE antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-DSE antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-DSE antibody

Western Blot detection against Immunogen (37.11kD).
Mouse Anti-DSE Monoclonal Antibody – Cat# MBS6160123

Testing Data of anti-DSE antibody

Detection limit for recombinant GST tagged SART2 is ~0.3ng/ml as a capture antibody.
Mouse Anti-DSE Monoclonal Antibody, Testing Data – Cat# MBS6160123

Other Notes

Small volumes of anti-DSE antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for DSE purchase

MBS6160123 is an antibody targeting DSE. Also known as DSE (Dermatan-sulfate Epimerase, DS Epimerase, Chondroitin-glucuronate 5-epimerase, Squamous Cell Carcinoma Antigen Recognized by T-cells 2, SART2, SART-2) (PE). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for DSE. It may not necessarily be applicable to this product.

NCBI GI #
7019521
NCBI GeneID
29940
NCBI Accession #
NP_037484
UniProt Primary Accession #
Q9UL01
UniProt Related Accession #
Q9UL01
GenBank Nucleotide #
NM_013352
NCBI Official Full Name
dermatan-sulfate epimerase isoform a
NCBI Official Synonym Full Names
dermatan sulfate epimerase
NCBI Official Symbol
DSE
NCBI Official Synonym Symbols
DSEP; DSEPI; SART2; EDSMC2; SART-2; DS-epi1
UniProt Protein Name
Dermatan-sulfate epimerase
UniProt Synonym Protein Names
Chondroitin-glucuronate 5-epimerase; Squamous cell carcinoma antigen recognized by T-cells 2
Protein Family
Dermatan-sulfate epimerase
UniProt Gene Name
DSE
UniProt Synonym Gene Names
SART2; DS epimerase; SART-2
UniProt Entry Name
DSE_HUMAN
NCBI Protein Information
dermatan-sulfate epimerase

NCBI Summary for DSE

The protein encoded by this gene is a tumor-rejection antigen. It is localized to the endoplasmic reticulum and functions to convert D-glucuronic acid to L-iduronic acid during the biosynthesis of dermatan sulfate. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. Mutations in this gene cause inmusculocontractural Ehlers-Danlos syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 9, and a paralogous gene exists on chromosome 18. [provided by RefSeq, Apr 2016]
Show more

UniProt Comments for DSE

SART2: Converts D-glucuronic acid to L-iduronic acid (IdoUA) residues. Belongs to the dermatan-sulfate isomerase family.

Protein type: Isomerase; Endoplasmic reticulum; Membrane protein, integral; EC 5.1.3.19; Glycan Metabolism - chondroitin sulfate biosynthesis; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 6q22

Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum; integral to membrane

Molecular Function: chondroitin-glucuronate 5-epimerase activity

Biological Process: chondroitin sulfate metabolic process; chondroitin sulfate biosynthetic process; glycosaminoglycan metabolic process; heparan sulfate proteoglycan biosynthetic process; carbohydrate metabolic process; pathogenesis; dermatan sulfate biosynthetic process

Disease: Ehlers-danlos Syndrome, Musculocontractural Type 2
Show more

Research Articles on DSE

1. DS-epi1, DS-epi2, and D4ST1 form homomers and are all part of a hetero-oligomeric complex where D4ST1 directly interacts with DS-epi1, but not with DS-epi2. The cooperation of DS-epi1 with D4ST1 may therefore explain the processive mode of the formation of iduronic acid blocks.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-DSE antibody

 Reference Product  PubMed Publications
 CHST14 antibody  >1 publications with DSE and CHST14
 BGN antibody  >1 publications with DSE and BGN

Pathways associated with anti-DSE antibody

 Products by Pathway  Pathway Diagram
 Chondroitin Sulfate/dermatan Sulfate Metabolism Pathway antibodies  Chondroitin Sulfate/dermatan Sulfate Metabolism Pathway Diagram
 Dermatan Sulfate Biosynthesis Pathway antibodies  Dermatan Sulfate Biosynthesis Pathway Diagram
 Disease Pathway antibodies  Disease Pathway Diagram
 Glycogen Storage Diseases Pathway antibodies  Glycogen Storage Diseases Pathway Diagram
 Glycosaminoglycan Biosynthesis - Chondroitin Sulfate / Dermatan Sulfate Pathway antibodies  Glycosaminoglycan Biosynthesis - Chondroitin Sulfate / Dermatan Sulfate Pathway Diagram
 Glycosaminoglycan Biosynthesis - Chondroitin Sulfate / Dermatan Sulfate Pathway antibodies  Glycosaminoglycan Biosynthesis - Chondroitin Sulfate / Dermatan Sulfate Pathway Diagram
 Glycosaminoglycan Metabolism Pathway antibodies  Glycosaminoglycan Metabolism Pathway Diagram
 MPS I - Hurler Syndrome Pathway antibodies  MPS I - Hurler Syndrome Pathway Diagram
 MPS II - Hunter Syndrome Pathway antibodies  MPS II - Hunter Syndrome Pathway Diagram
 MPS IIIA - Sanfilippo Syndrome A Pathway antibodies  MPS IIIA - Sanfilippo Syndrome A Pathway Diagram

Diseases associated with anti-DSE antibody

 Disease Name  Pubmed Publications
 Kidney Diseases Antibodies  >26 publications with DSE and Kidney Diseases
 Nervous System Diseases Antibodies  >21 publications with DSE and Nervous System Diseases
 Necrosis Antibodies  >15 publications with DSE and Necrosis
 Liver Diseases Antibodies  >11 publications with DSE and Liver Diseases
 Fibrosis Antibodies  >9 publications with DSE and Fibrosis
 Inflammation Antibodies  >8 publications with DSE and Inflammation
 Brain Diseases Antibodies  >8 publications with DSE and Brain Diseases
 Carcinoma, Squamous Cell Antibodies  >7 publications with DSE and Carcinoma, Squamous Cell
 Adenocarcinoma Antibodies  >5 publications with DSE and Adenocarcinoma
 Hypersensitivity Antibodies  >5 publications with DSE and Hypersensitivity

Organs/Tissues associated with anti-DSE antibody

 Organ/Tissue Name  Pubmed Publications
 Heart Antibodies  >390 publications with DSE and Heart
 Blood Antibodies  >194 publications with DSE and Blood
 Vascular Antibodies  >72 publications with DSE and Vascular
 Brain Antibodies  >70 publications with DSE and Brain
 Muscle Antibodies  >51 publications with DSE and Muscle
 Kidney Antibodies  >37 publications with DSE and Kidney
 Liver Antibodies  >28 publications with DSE and Liver
 Lung Antibodies  >21 publications with DSE and Lung
 Nerve Antibodies  >15 publications with DSE and Nerve
 Bone Antibodies  >8 publications with DSE and Bone
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000