Mouse Anti-SASH1 Monoclonal Antibody – Cat# MBS6160124

SASH1 Antibody – Mouse Monoclonal

Name: SASH1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6160124
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6160124

MBS6160124 is an antibody targeting SASH1. Also known as SASH1 (SAM and SH3 Domain-containing Protein 1, KIAA0790, Proline-glutamate Repeat-containing Protein, PEPE1) (PE). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

SASH1, Monoclonal Antibody

Full Product Name

SASH1 (SAM and SH3 Domain-containing Protein 1, KIAA0790, Proline-glutamate Repeat-containing Protein, PEPE1) (PE)

Product Gene Name

anti-SASH1 antibody

Product Synonym Names

dJ323M4; dJ323M4.1; RP3-323M4.1; SH3D6A

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

10B7

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

Purity/Purification

Purified by Protein A Affinity Chromatography

Specificity

Recognizes human SASH1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

607955

3D Structure

ModBase 3D Structure for O94885

Immunogen

Partial recombinant corresponding to aa1066-1176 from SASH1 (NP_056093) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

ENTSLQEHGVKLGPALTRKVSCARGVDLETLTENKLHAEGIDLTEEPYSDKHGRCGIPEALVQRYAEDLDQPERDVAANMDQIRVKQLRKQHRMAIPSGGLTEICRKPVS*

Conjugate

Product Categories/Family for anti-SASH1 antibody

Antibodies; Tumor Suppressors

Applications Tested/Suitable for anti-SASH1 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-SASH1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-SASH1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for SASH1. It may not necessarily be applicable to this product.

NCBI GI #

1519245377

NCBI GeneID

23328

NCBI Accession #

NM_015278.5

UniProt Primary Accession #

O94885

UniProt Related Accession #

O94885

GenBank Nucleotide #

NM_015278

NCBI Official Full Name

Homo sapiens SAM and SH3 domain containing 1 (SASH1), transcript variant 1, mRNA

NCBI Official Synonym Full Names

SAM and SH3 domain containing 1

NCBI Official Symbol

SASH1

NCBI Official Synonym Symbols

DUH1; CAPOK; SH3D6A; dJ323M4.1

UniProt Protein Name

SAM and SH3 domain-containing protein 1

UniProt Synonym Protein Names

Proline-glutamate repeat-containing protein

Protein Family

SAM and SH3 domain-containing protein

UniProt Gene Name

SASH1

UniProt Synonym Gene Names

KIAA0790; PEPE1

UniProt Entry Name

SASH1_HUMAN

NCBI Protein Information

SAM and SH3 domain-containing protein 1

NCBI Summary for SASH1

This gene encodes a scaffold protein involved in the TLR4 signaling pathway that may stimulate cytokine production and endothelial cell migration in response to invading pathogens. The encoded protein has also been described as a potential tumor suppressor that may negatively regulate proliferation, apoptosis, and invasion of cancer cells, and reduced expression of this gene has been observed in multiple human cancers. Mutations in this gene may be associated with abnormal skin pigmentation in human patients. [provided by RefSeq, Oct 2016]

Research Articles on SASH1

1. Findings indicate that miR-130b was highly expressed, while SAM and SH3 domain containing 1 protein (SASH1) was the opposite in both the oesophageal squamous cell carcinoma (ESCC) tissues and cells.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.