• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Splicing Factor 1 (SF1) Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6160215

MBS6160215 is an antibody targeting SF1. Also known as Splicing Factor 1 (SF1, Mammalian Branch Point-binding Protein, BBP, mBBP, Transcription Factor ZFM1, Zinc Finger Gene in MEN1 Locus, ZFM1, Zinc Finger Protein 162, ZNF162, D11S636, ZCCHC25) (PE).… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Splicing Factor 1 (SF1), Monoclonal Antibody
Full Product Name
Splicing Factor 1 (SF1, Mammalian Branch Point-binding Protein, BBP, mBBP, Transcription Factor ZFM1, Zinc Finger Gene in MEN1 Locus, ZFM1, Zinc Finger Protein 162, ZNF162, D11S636, ZCCHC25) (PE)
Product Gene Name
anti-SF1 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E12
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human SF1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
68kDa
OMIM
601516
3D Structure
ModBase 3D Structure for Q15637
Immunogen
Partial recombinant corresponding to aa1-111 of human SF1 (NP_004621) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERH*
Conjugate
PE

Product Categories/Family for anti-SF1 antibody

Antibodies; Splicing Factors
Applications Tested/Suitable for anti-SF1 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-SF1 antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-SF1 antibody

Western Blot detection against Immunogen (38.21kD).
Mouse Anti-SF1 Monoclonal Antibody – Cat# MBS6160215

Immunohistochemistry (IHC) of anti-SF1 antibody

Immunoperoxidase of monoclonal antibody to SF1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml]
Mouse Anti-SF1 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6160215

Immunofluorescence (IF) of anti-SF1 antibody

Immunofluorescence of monoclonal antibody to SF1 on HeLa cell. [antibody concentration 10ug/ml]
Mouse Anti-SF1 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6160215

Testing Data of anti-SF1 antibody

Detection limit for recombinant GST tagged SF1 is ~0.03ng/ml as a capture antibody.
Mouse Anti-SF1 Monoclonal Antibody, Testing Data – Cat# MBS6160215

Other Notes

Small volumes of anti-SF1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for SF1. It may not necessarily be applicable to this product.

NCBI GI #
42544130
NCBI GeneID
7536
NCBI Accession #
NP_004621
UniProt Primary Accession #
Q15637
UniProt Related Accession #
Q15637
GenBank Nucleotide #
NM_004630
NCBI Official Full Name
splicing factor 1 isoform 1
NCBI Official Synonym Full Names
splicing factor 1
NCBI Official Symbol
SF1
NCBI Official Synonym Symbols
BBP; MBBP; ZFM1; ZNF162; D11S636; ZCCHC25
UniProt Protein Name
Splicing factor 1
UniProt Synonym Protein Names
Mammalian branch point-binding protein; BBP; mBBP; Transcription factor ZFM1; Zinc finger gene in MEN1 locus; Zinc finger protein 162
Protein Family
Splicing factor
UniProt Gene Name
SF1
UniProt Synonym Gene Names
ZFM1; ZNF162; BBP; mBBP
UniProt Entry Name
SF01_HUMAN
NCBI Protein Information
splicing factor 1

NCBI Summary for SF1

This gene encodes a nuclear pre-mRNA splicing factor. The encoded protein specifically recognizes the intron branch point sequence at the 3' splice site, together with the large subunit of U2 auxiliary factor (U2AF), and is required for the early stages of spliceosome assembly. It also plays a role in nuclear pre-mRNA retention and transcriptional repression. The encoded protein contains an N-terminal U2AF ligand motif, a central hnRNP K homology motif and quaking 2 region which bind a key branch-site adenosine within the branch point sequence, a zinc knuckles domain, and a C-terminal proline-rich domain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016]
Show more

UniProt Comments for SF1

SF1: a splicing factor necessary for the ATP-dependent first step of spliceosome assembly. Binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. May act as transcription repressor. Phosphorylation of SF1 by cGMP-dependent protein kinase regulates spliceosome assembly. Binds U2AF2. Interacts with U1 snRNA. Binds EWSR1, FUS and TAF15. Six alternatively spliced isoforms have been described.

Protein type: RNA splicing; RNA-binding; Transcription, coactivator/corepressor; Spliceosome

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: nucleoplasm; spliceosome; ribosome; nucleus

Molecular Function: zinc ion binding; RNA binding; transcription corepressor activity

Biological Process: nuclear mRNA splicing, via spliceosome; nuclear mRNA 3'-splice site recognition; Leydig cell differentiation; transcription, DNA-dependent; regulation of transcription, DNA-dependent; negative regulation of smooth muscle cell proliferation; male sex determination; spliceosome assembly; regulation of steroid biosynthetic process
Show more

Research Articles on SF1

1. SF1 Phosphorylation Enhances Specific Binding to U2AF(65) and Reduces Binding to 3'-Splice-Site RNA

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-SF1 antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >15 publications with SF1 and Nervous System Diseases
 Hyperplasia Antibodies  >12 publications with SF1 and Hyperplasia
 Death Antibodies  >10 publications with SF1 and Death
 Lung Diseases Antibodies  >7 publications with SF1 and Lung Diseases
 Heart Diseases Antibodies  >6 publications with SF1 and Heart Diseases
 Infertility, Female Antibodies  >6 publications with SF1 and Infertility, Female
 Hypertension Antibodies  >6 publications with SF1 and Hypertension
 Infertility, Male Antibodies  >5 publications with SF1 and Infertility, Male
 Inflammation Antibodies  >5 publications with SF1 and Inflammation
 Necrosis Antibodies  >5 publications with SF1 and Necrosis

Organs/Tissues associated with anti-SF1 antibody

 Organ/Tissue Name  Pubmed Publications
 Testis Antibodies  >119 publications with SF1 and Testis
 Ovary Antibodies  >84 publications with SF1 and Ovary
 Brain Antibodies  >56 publications with SF1 and Brain
 Adrenal Gland Antibodies  >54 publications with SF1 and Adrenal Gland
 Blood Antibodies  >53 publications with SF1 and Blood
 Muscle Antibodies  >30 publications with SF1 and Muscle
 Pituitary Gland Antibodies  >21 publications with SF1 and Pituitary Gland
 Kidney Antibodies  >19 publications with SF1 and Kidney
 Liver Antibodies  >19 publications with SF1 and Liver
 Embryonic Tissue Antibodies  >18 publications with SF1 and Embryonic Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000