Mouse Anti-SF3B3 Monoclonal Antibody – Cat# MBS6160218

Detection limit for recombinant GST tagged SF3B3 is 0.1ng/ml as a capture antibody.

SF3B3 Antibody – Mouse Monoclonal

Name: SF3B3 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6160218
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6160218

MBS6160218 is an antibody targeting SF3B3. Also known as SF3B3 (Splicing Factor 3B Subunit 3, KIAA0017, Pre-mRNA-splicing Factor SF3b 130kD Subunit, SF3b130, STAF130, Spliceosome-associated Protein 130, SAP 130, SAP130) (PE). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

SF3B3, Monoclonal Antibody

Full Product Name

SF3B3 (Splicing Factor 3B Subunit 3, KIAA0017, Pre-mRNA-splicing Factor SF3b 130kD Subunit, SF3b130, STAF130, Spliceosome-associated Protein 130, SAP 130, SAP130) (PE)

Product Gene Name

anti-SF3B3 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

2F1

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human SF3B3.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

605592

3D Structure

ModBase 3D Structure for Q15393

Immunogen

Partial recombinant corresponding to aa819-930 from SF3B3 (NP_036558) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYK*

Conjugate

Product Categories/Family for anti-SF3B3 antibody

Antibodies; Splicing Factors

Applications Tested/Suitable for anti-SF3B3 antibody

ELISA (EIA)

Application Notes for anti-SF3B3 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-SF3B3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for SF3B3. It may not necessarily be applicable to this product.

NCBI GI #

1519315032

NCBI GeneID

23450

NCBI Accession #

NM_012426.5

UniProt Primary Accession #

Q15393

UniProt Related Accession #

Q15393

GenBank Nucleotide #

NM_012426

NCBI Official Full Name

Homo sapiens splicing factor 3b subunit 3 (SF3B3), mRNA

NCBI Official Synonym Full Names

splicing factor 3b subunit 3

NCBI Official Symbol

SF3B3

NCBI Official Synonym Symbols

RSE1; SAP130; SF3b130; STAF130

UniProt Protein Name

Splicing factor 3B subunit 3

UniProt Synonym Protein Names

Pre-mRNA-splicing factor SF3b 130 kDa subunit; SF3b130; STAF130; Spliceosome-associated protein 130

Protein Family

Probable splicing factor

UniProt Gene Name

SF3B3

UniProt Synonym Gene Names

KIAA0017; SAP130; SF3b130; SAP 130

UniProt Entry Name

SF3B3_HUMAN

NCBI Protein Information

splicing factor 3B subunit 3

NCBI Summary for SF3B3

This gene encodes subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair. [provided by RefSeq, Jul 2008]

UniProt Comments for SF3B3

SF3B3: Subunit of the splicing factor SF3B required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron. Belongs to the RSE1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; RNA splicing; Spliceosome

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: small nuclear ribonucleoprotein complex; nucleoplasm; spliceosome; U12-dependent spliceosome

Molecular Function: protein binding; RNA binding

Biological Process: RNA splicing, via transesterification reactions; nuclear mRNA splicing, via spliceosome; RNA splicing; protein complex assembly; gene expression; mRNA processing

Research Articles on SF3B3

1. These results suggest SF3B3 as a key regulator of EZH2 pre-mRNA splicing and SF3B3 may represent a novel prognostic factor and potential therapeutic target in clear cell renal cell carcinoma

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.