• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

TENM1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6160679

Teneurin-1 may function as a cellular signal transducer. It exists as a disulfide-linked homodimer transmembrane protein. It is expressed in fetal brain. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
TENM1, Monoclonal Antibody
Full Product Name
TENM1 (ODZ1, Teneurin-1, Ten-1, Protein Odd Oz/Ten-m Homolog 1, Tenascin-M1, Ten-m1, Teneurin Transmembrane Protein 1, TNM1) (PE)
Product Gene Name
anti-TENM1 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G8
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human ODZ1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
OMIM
300588
3D Structure
ModBase 3D Structure for Q9UKZ4
Immunogen
Partial recombinant corresponding to aa2616-2725 from ODZ1 (NP_055068) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR
Conjugate
PE

Product Categories/Family for anti-TENM1 antibody

Antibodies; Extracellular Matrix Proteins
Applications Tested/Suitable for anti-TENM1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-TENM1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-TENM1 antibody

Western Blot detection against Immunogen (38.21kD).
Mouse Anti-TENM1 Monoclonal Antibody – Cat# MBS6160679

Testing Data of anti-TENM1 antibody

Detection limit for recombinant GST tagged ODZ1 is ~1ng/ml as a capture antibody.
Mouse Anti-TENM1 Monoclonal Antibody, Testing Data – Cat# MBS6160679

Other Notes

Small volumes of anti-TENM1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for TENM1 purchase

MBS6160679 is an antibody targeting TENM1. Also known as TENM1 (ODZ1, Teneurin-1, Ten-1, Protein Odd Oz/Ten-m Homolog 1, Tenascin-M1, Ten-m1, Teneurin Transmembrane Protein 1, TNM1) (PE). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for TENM1. It may not necessarily be applicable to this product.

NCBI GI #
110347400
NCBI Accession #
NP_055068
UniProt Primary Accession #
Q9UKZ4
GenBank Nucleotide #
NM_014253
NCBI Official Full Name
teneurin-1 isoform 3
UniProt Protein Name
Teneurin-1
UniProt Synonym Protein Names
Protein Odd Oz/ten-m homolog 1; Tenascin-M1; Ten-m1; Teneurin transmembrane protein 1Cleaved into the following 2 chains:Ten-1 intracellular domain; IDten-1; Ten-1 ICD; Teneurin C-terminal-associated peptide; TCPA-1Alternative name(s):Ten-1 extracellular domain; Ten-1 ECD
UniProt Gene Name
TENM1
UniProt Synonym Gene Names
ODZ1; TNM1; Ten-1; Ten-m1; IDten-1; Ten-1 ICD; TCPA-1; Ten-1 ECD
UniProt Entry Name
TEN1_HUMAN

UniProt Comments for TENM1

ODZ1: May function as a cellular signal transducer. Belongs to the tenascin family. Teneurin subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: Xq25

Cellular Component: Golgi apparatus; cytoskeleton; nuclear matrix; integral to plasma membrane; perinuclear region of cytoplasm; endoplasmic reticulum; cytoplasm; extracellular region; plasma membrane; nuclear speck; nucleus

Molecular Function: heparin binding; protein homodimerization activity; protein heterodimerization activity

Biological Process: positive regulation of filopodium formation; nervous system development; negative regulation of cell proliferation; positive regulation of MAP kinase activity; transcription, DNA-dependent; positive regulation of actin filament polymerization; regulation of transcription from RNA polymerase III promoter; neuropeptide signaling pathway; immune response; positive regulation of peptidyl-serine phosphorylation
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-TENM1 antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >1 publications with TENM1 and Nervous System Diseases
 Neoplasm Metastasis Antibodies  >1 publications with TENM1 and Neoplasm Metastasis

Organs/Tissues associated with anti-TENM1 antibody

 Organ/Tissue Name  Pubmed Publications
 Nerve Antibodies  >1 publications with TENM1 and Nerve
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000