• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Tetratricopeptide Repeat Protein 8 (TTC8) Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6160881

MBS6160881 is an antibody targeting TTC8. Also known as Tetratricopeptide Repeat Protein 8 (TPR Repeat Protein 8, TTC8, Bardet-Biedl Syndrome 8 Protein, BBS8, RP51) (PE). Reactive in Human, Mouse, Rat. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Tetratricopeptide Repeat Protein 8 (TTC8), Monoclonal Antibody
Full Product Name
Tetratricopeptide Repeat Protein 8 (TPR Repeat Protein 8, TTC8, Bardet-Biedl Syndrome 8 Protein, BBS8, RP51) (PE)
Product Gene Name
anti-TTC8 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
7E2
Host
Mouse
Species Reactivity
Human, Mouse, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human TTC8. Species Crossreactivity: mouse and rat.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
OMIM
209900
3D Structure
ModBase 3D Structure for Q8TAM2
Immunogen
Partial recombinant corresponding to aa416-515 from human TTC8 (NP_653197) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AHQCFRLALVNNNNHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGDLQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFAM
Conjugate
PE

Product Categories/Family for anti-TTC8 antibody

Antibodies; Tetratricopeptide Repeat Proteins
Applications Tested/Suitable for anti-TTC8 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-TTC8 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-TTC8 antibody

Western Blot detection against Immunogen (37kD).
Mouse Anti-TTC8 Monoclonal Antibody – Cat# MBS6160881

Western Blot (WB) of anti-TTC8 antibody

TTC8 monoclonal antibody. Western Blot analysis of TTC8 expression in PC-12.
Mouse Anti-TTC8 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6160881

Western Blot (WB) of anti-TTC8 antibody

TTC8 monoclonal antibody, Western Blot analysis of TTC8 expression in NIH/3T3.
Mouse Anti-TTC8 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6160881

Other Notes

Small volumes of anti-TTC8 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for TTC8. It may not necessarily be applicable to this product.

NCBI GI #
53759120
NCBI GeneID
123016
NCBI Accession #
NP_653197
UniProt Primary Accession #
Q8TAM2
UniProt Related Accession #
Q8TAM2
GenBank Nucleotide #
NM_144596
NCBI Official Full Name
tetratricopeptide repeat protein 8 isoform A
NCBI Official Synonym Full Names
tetratricopeptide repeat domain 8
NCBI Official Symbol
TTC8
NCBI Official Synonym Symbols
BBS8; RP51
UniProt Protein Name
Tetratricopeptide repeat protein 8
UniProt Synonym Protein Names
Bardet-Biedl syndrome 8 protein
Protein Family
Tetratricopeptide repeat protein
UniProt Gene Name
TTC8
UniProt Synonym Gene Names
BBS8; TPR repeat protein 8
UniProt Entry Name
TTC8_HUMAN
NCBI Protein Information
tetratricopeptide repeat protein 8

NCBI Summary for TTC8

This gene encodes a protein that has been directly linked to Bardet-Biedl syndrome. The primary features of this syndrome include retinal dystrophy, obesity, polydactyly, renal abnormalities and learning disabilities. Experimentation in non-human eukaryotes suggests that this gene is expressed in ciliated cells and that it is involved in the formation of cilia. A mutation in this gene has also been implicated in nonsyndromic retinitis pigmentosa. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Show more

Research Articles on TTC8

1. Two novel mutations and three previously reported variants, identified in the present study, further extend the body of evidence implicating BBS6, BBS7, BBS8, and BBS10 in causing Bardet-Biedl Syndrome.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-TTC8 antibody

 Products by Pathway  Pathway Diagram
 Assembly Of The Primary Cilium Pathway antibodies  Assembly Of The Primary Cilium Pathway Diagram
 BBSome-mediated Cargo-targeting To Cilium Pathway antibodies  BBSome-mediated Cargo-targeting To Cilium Pathway Diagram
 Cargo Trafficking To The Periciliary Membrane Pathway antibodies  Cargo Trafficking To The Periciliary Membrane Pathway Diagram
 Organelle Biogenesis And Maintenance Pathway antibodies  Organelle Biogenesis And Maintenance Pathway Diagram

Diseases associated with anti-TTC8 antibody

 Disease Name  Pubmed Publications
 Bardet-Biedl Syndrome Antibodies  >14 publications with TTC8 and Bardet-Biedl Syndrome
 Brain Diseases Antibodies  >9 publications with TTC8 and Brain Diseases
 Disease Models, Animal Antibodies  >2 publications with TTC8 and Disease Models, Animal
 Atrophy Antibodies  >1 publications with TTC8 and Atrophy
 RETINITIS PIGMENTOSA 51 Antibodies  >1 publications with TTC8 and RETINITIS PIGMENTOSA 51

Organs/Tissues associated with anti-TTC8 antibody

 Organ/Tissue Name  Pubmed Publications
 Eye Antibodies  >5 publications with TTC8 and Eye
 Nerve Antibodies  >2 publications with TTC8 and Nerve
 Blood Antibodies  >2 publications with TTC8 and Blood
 Kidney Antibodies  >2 publications with TTC8 and Kidney
 Lung Antibodies  >1 publications with TTC8 and Lung
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000