• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

GTF3C3 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6161825

MBS6161825 is an antibody targeting GTF3C3. Also known as GTF3C3 (General Transcription Factor IIIC, Polypeptide 3, 102kD, TFIIIC102, TFIIICgamma, TFiiiC2-102) (AP). Host: Mouse. Mouse monoclonal antibody raised against a partial recombinant GTF3C3. More details

$995 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
GTF3C3, Monoclonal Antibody
Full Product Name
GTF3C3 (General Transcription Factor IIIC, Polypeptide 3, 102kD, TFIIIC102, TFIIICgamma, TFiiiC2-102) (AP)
Product Gene Name
anti-GTF3C3 antibody
Product Synonym Names
General Transcription Factor IIIC; Polypeptide 3; 102kD; TFIIIC102; TFIIICgamma; TFiiiC2-102
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2D8
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Purity/Purification
Purified
Specificity
Recognizes GTF3C3.
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
101kDa
OMIM
604888
3D Structure
ModBase 3D Structure for Q9Y5Q9
Immunogen
GTF3C3 (NP_036218, 112aa-214aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TPEQPTAGDVFVLEMVLNRETKKMMKEKRPRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNP
Conjugate
AP

Product Categories/Family for anti-GTF3C3 antibody

Antibodies; Transcription Factors
Applications Tested/Suitable for anti-GTF3C3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-GTF3C3 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-GTF3C3 antibody

GTF3C3 monoclonal antibody (M01), clone 2D8 Western Blot analysis of GTF3C3 expression in Hela S3 NE.
Mouse Anti-GTF3C3 Monoclonal Antibody – Cat# MBS6161825

Western Blot (WB) of anti-GTF3C3 antibody

GTF3C3 monoclonal antibody (M01), clone 2D8. Western Blot analysis of GTF3C3 expression in NIH/3T3.
Mouse Anti-GTF3C3 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6161825

Western Blot (WB) of anti-GTF3C3 antibody

GTF3C3 monoclonal antibody (M01), clone 2D8. Western Blot analysis of GTF3C3 expression in Raw 264.7.
Mouse Anti-GTF3C3 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6161825

Other Notes

Small volumes of anti-GTF3C3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for GTF3C3. It may not necessarily be applicable to this product.

NCBI GI #
6912398
NCBI GeneID
9330
NCBI Accession #
NP_036218
UniProt Primary Accession #
Q9Y5Q9
UniProt Related Accession #
Q9Y5Q9
GenBank Nucleotide #
NM_012086
NCBI Official Full Name
general transcription factor 3C polypeptide 3 isoform 1
NCBI Official Synonym Full Names
general transcription factor IIIC subunit 3
NCBI Official Symbol
GTF3C3
NCBI Official Synonym Symbols
TFIIIC102; TFIIICgamma; TFiiiC2-102
UniProt Protein Name
General transcription factor 3C polypeptide 3
UniProt Synonym Protein Names
Transcription factor IIIC 102 kDa subunit; TFIIIC 102 kDa subunit; TFIIIC102; Transcription factor IIIC subunit gamma
Protein Family
General transcription factor 3C polypeptide
UniProt Gene Name
GTF3C3
UniProt Synonym Gene Names
TFIIIC 102 kDa subunit; TFIIIC102; TF3C-gamma
UniProt Entry Name
TF3C3_HUMAN
NCBI Protein Information
general transcription factor 3C polypeptide 3

NCBI Summary for GTF3C3

The protein encoded by this gene is part of the TFIIIC2 complex, which binds to the promoters of small nuclear and cytoplasmic RNA genes in order to recruit RNA polymerase III. The TFIIIC2 complex is composed of six subunits. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
Show more

UniProt Comments for GTF3C3

GTF3C3: Involved in RNA polymerase III-mediated transcription. Integral, tightly associated component of the DNA-binding TFIIIC2 subcomplex that directly binds tRNA and virus-associated RNA promoters. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 2q33.1

Cellular Component: nucleoplasm; transcription factor TFIIIC complex

Molecular Function: protein binding; DNA binding

Biological Process: transcription from RNA polymerase III promoter; transcription, DNA-dependent; 5S class rRNA transcription; gene expression; tRNA transcription from RNA polymerase III promoter
Show more

Research Articles on GTF3C3

1. DEDD and FLAME-3 form nuclear complexes with TFIIIC102

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-GTF3C3 antibody

 Products by Pathway  Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 RNA Polymerase I, RNA Polymerase III, And Mitochondrial Transcription Pathway antibodies  RNA Polymerase I, RNA Polymerase III, And Mitochondrial Transcription Pathway Diagram
 RNA Polymerase III Abortive And Retractive Initiation Pathway antibodies  RNA Polymerase III Abortive And Retractive Initiation Pathway Diagram
 RNA Polymerase III Transcription Pathway antibodies  RNA Polymerase III Transcription Pathway Diagram
 RNA Polymerase III Transcription Initiation Pathway antibodies  RNA Polymerase III Transcription Initiation Pathway Diagram
 RNA Polymerase III Transcription Initiation From Type 1 Promoter Pathway antibodies  RNA Polymerase III Transcription Initiation From Type 1 Promoter Pathway Diagram
 RNA Polymerase III Transcription Initiation From Type 2 Promoter Pathway antibodies  RNA Polymerase III Transcription Initiation From Type 2 Promoter Pathway Diagram

Diseases associated with anti-GTF3C3 antibody

 Disease Name  Pubmed Publications
 Neurobehavioral Manifestations Antibodies  >1 publications with GTF3C3 and Neurobehavioral Manifestations

Organs/Tissues associated with anti-GTF3C3 antibody

 Organ/Tissue Name  Pubmed Publications
 Skin Antibodies  >1 publications with GTF3C3 and Skin
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000