• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

SREBF1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6162854

This gene encodes a transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a decamer flanking the low density lipoprotein receptor gene and some genes involved in sterol biosynthesis. The protein is synthesized as a precursor that… More details

$995 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
SREBF1, Monoclonal Antibody
Full Product Name
SREBF1 (Sterol Regulatory Element Binding Transcription Factor 1, SREBP-1c, SREBP1, bHLHd1) (AP)
Product Gene Name
anti-SREBF1 antibody
Product Synonym Names
Sterol Regulatory Element Binding Transcription Factor 1; SREBP-1c; SREBP1; bHLHd1
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G4
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Purity/Purification
Purified
Specificity
Recognizes human SREBF1.
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa801-900 of human SREBF1 (AAH57388) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL
Conjugate
AP

Product Categories/Family for anti-SREBF1 antibody

Antibodies; Transcription Factors
Applications Tested/Suitable for anti-SREBF1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-SREBF1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-SREBF1 antibody

Western Blot analysis of SREBF1 expression in HeLa using 252086.
Mouse Anti-SREBF1 Monoclonal Antibody – Cat# MBS6162854

Western Blot (WB) of anti-SREBF1 antibody

Western Blot detection against immunogen (36.63kD).
Mouse Anti-SREBF1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6162854

Testing Data of anti-SREBF1 antibody

Detection limit for 252086 is ~0.03ng/ml as a capture antibody.
Mouse Anti-SREBF1 Monoclonal Antibody, Testing Data – Cat# MBS6162854

Other Notes

Small volumes of anti-SREBF1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SREBF1 purchase

MBS6162854 is an antibody targeting SREBF1. Also known as SREBF1 (Sterol Regulatory Element Binding Transcription Factor 1, SREBP-1c, SREBP1, bHLHd1) (AP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for SREBF1. It may not necessarily be applicable to this product.

NCBI GI #
34785767
NCBI GeneID
6720
NCBI Accession #
AAH57388
UniProt Related Accession #
P36956
NCBI Official Full Name
Sterol regulatory element binding transcription factor 1
NCBI Official Synonym Full Names
sterol regulatory element binding transcription factor 1
NCBI Official Symbol
SREBF1
NCBI Official Synonym Symbols
SREBP1; bHLHd1
NCBI Protein Information
sterol regulatory element-binding protein 1

NCBI Summary for SREBF1

This gene encodes a basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a motif that is found in the promoter of the low density lipoprotein receptor gene and other genes involved in sterol biosynthesis. The encoded protein is synthesized as a precursor that is initially attached to the nuclear membrane and endoplasmic reticulum. Following cleavage, the mature protein translocates to the nucleus and activates transcription. This cleaveage is inhibited by sterols. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative promoter usage and splicing result in multiple transcript variants, including SREBP-1a and SREBP-1c, which correspond to RefSeq transcript variants 2 and 3, respectively. [provided by RefSeq, Nov 2017]
Show more

Research Articles on SREBF1

1. Downregulation of SREBP inhibits tumor growth and initiation by altering cellular lipid metabolism in colon cancer.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000