Mouse Anti-ADAMDEC1 Monoclonal Antibody – Cat# MBS6163924

Detection limit for recombinant GST tagged ADAMDEC1 is approximately 1ng/ml as a capture antibody.

ADAMDEC1 Antibody – Mouse Monoclonal

Name: ADAMDEC1 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6163924
Price: 995 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6163924

This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their… More details

$995 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

ADAMDEC1, Monoclonal Antibody

Full Product Name

ADAMDEC1 (ADAM-like, decysin 1, M12.219) (AP)

Product Gene Name

anti-ADAMDEC1 antibody

Product Synonym Names

ADAM-like; decysin 1; M12.219

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

1G2

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

Purity/Purification

Purified

Specificity

Recognizes ADAMDEC1.

Preparation and Storage

Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

53kDa

OMIM

606393

3D Structure

ModBase 3D Structure for O15204

Immunogen

ADAMDEC1 (NP_055294, 361aa-470aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

PDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

Conjugate

Product Categories/Family for anti-ADAMDEC1 antibody

Antibodies; Matrix Metalloproteinases

Applications Tested/Suitable for anti-ADAMDEC1 antibody

Western Blot (WB)

Application Notes for anti-ADAMDEC1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-ADAMDEC1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ADAMDEC1 purchase

MBS6163924 is an antibody targeting ADAMDEC1. Also known as ADAMDEC1 (ADAM-like, decysin 1, M12.219) (AP). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for ADAMDEC1. It may not necessarily be applicable to this product.

NCBI GI #

7657319

NCBI GeneID

27299

NCBI Accession #

NP_055294

UniProt Primary Accession #

O15204

UniProt Related Accession #

O15204

GenBank Nucleotide #

NM_014479

NCBI Official Full Name

ADAM DEC1 isoform 1

NCBI Official Synonym Full Names

ADAM like decysin 1

NCBI Official Symbol

ADAMDEC1

NCBI Official Synonym Symbols

M12.219

UniProt Protein Name

ADAM DEC1

UniProt Synonym Protein Names

A disintegrin and metalloproteinase domain-like protein decysin-1

Protein Family

ADAM

UniProt Gene Name

ADAMDEC1

UniProt Synonym Gene Names

ADAM-like protein decysin-1

UniProt Entry Name

ADEC1_HUMAN

NCBI Protein Information

ADAM DEC1

UniProt Comments for ADAMDEC1

Function: May play an important role in the control of the immune response and during pregnancy

By similarity.

Cofactor: Binds 1 zinc ion per subunit

By similarity.

Subcellular location: Secreted

By similarity.

Tissue specificity: Expressed highly in the small intestine and appendix, moderately in lymph node, mucosal lining of the colon, thymus, spleen and very weakly in the bone marrow. Predominantly expressed in dendritic cells (DC) of the germinal center. Weakly expressed in monocyte and highly expressed in macrophage. Absent in immature DC. Ref.1 Ref.5

Induction: Induced during DC maturation and up-regulated in response to T-cell signals. In macrophage up-regulated by bacterial lipopolysaccharides (LPS). Up-regulated by 1-alpha,25-dihydroxyvitamin D3 during differentiation of primary monocyte into macrophage. Ref.1 Ref.5

Sequence similarities: Contains 1 disintegrin domain.Contains 1 peptidase M12B domain.

Research Articles on ADAMDEC1

1. Data suggest that activated platelets release ADAMDEC1, which hydrolyzes pro-EGF (epidermal growth factor) to soluble, active HMW-EGF; proteolytic cleavage of pro-EGF first occurs at the C-terminal arginyl residue of the EGF domain; proteolysis is the regulated, rate-limiting step in generating soluble EGF from activated platelets.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ADAMDEC1 antibody

Reference Product	PubMed Publications
ADAM28 antibody	>4 publications with ADAMDEC1 and ADAM28
SLAMF8 antibody	>1 publications with ADAMDEC1 and SLAMF8

Diseases associated with anti-ADAMDEC1 antibody

Disease Name	Pubmed Publications
Adenocarcinoma Antibodies	>3 publications with ADAMDEC1 and Adenocarcinoma
Liver Neoplasms Antibodies	>2 publications with ADAMDEC1 and Liver Neoplasms
Carcinoma Antibodies	>2 publications with ADAMDEC1 and Carcinoma
Liver Diseases Antibodies	>2 publications with ADAMDEC1 and Liver Diseases
Inflammation Antibodies	>2 publications with ADAMDEC1 and Inflammation
Necrosis Antibodies	>2 publications with ADAMDEC1 and Necrosis
Lymphatic Diseases Antibodies	>1 publications with ADAMDEC1 and Lymphatic Diseases
Neoplasms, Experimental Antibodies	>1 publications with ADAMDEC1 and Neoplasms, Experimental
Carcinoma, Hepatocellular Antibodies	>1 publications with ADAMDEC1 and Carcinoma, Hepatocellular
Atherosclerosis Antibodies	>1 publications with ADAMDEC1 and Atherosclerosis

Organs/Tissues associated with anti-ADAMDEC1 antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>5 publications with ADAMDEC1 and Blood
Muscle Antibodies	>2 publications with ADAMDEC1 and Muscle
Kidney Antibodies	>1 publications with ADAMDEC1 and Kidney
Lung Antibodies	>1 publications with ADAMDEC1 and Lung
Connective Tissue Antibodies	>1 publications with ADAMDEC1 and Connective Tissue
Intestine Antibodies	>1 publications with ADAMDEC1 and Intestine