Mouse Anti-ATP6V0D1 Monoclonal Antibody – Cat# MBS6164990

ATP6V0D1 monoclonal antibody (M02), clone 3B8. Western Blot analysis of ATP6V0D1 expression in HeLa.

ATP6V0D1 Antibody – Mouse Monoclonal

Name: ATP6V0D1 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6164990
Price: 995 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6164990

MBS6164990 is an antibody targeting ATP6V0D1. Also known as ATP6V0D1 (ATPase, H+ Transporting, Lysosomal 38kD, V0 Subunit d1, ATP6D, ATP6DV, P39, VATX, VMA6, VPATPD) (AP). Host: Mouse. More details

$995 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

ATP6V0D1, Monoclonal Antibody

Full Product Name

ATP6V0D1 (ATPase, H+ Transporting, Lysosomal 38kD, V0 Subunit d1, ATP6D, ATP6DV, P39, VATX, VMA6, VPATPD) (AP)

Product Gene Name

anti-ATP6V0D1 antibody

Product Synonym Names

ATPase; H+ Transporting; Lysosomal 38kD; V0 Subunit d1; ATP6D; ATP6DV; P39; VATX; VMA6; VPATPD

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

3B8

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

Purity/Purification

Purified

Specificity

Recognizes ATP6V0D1.

Preparation and Storage

Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

40,329 Da

OMIM

607028

3D Structure

ModBase 3D Structure for P61421

Immunogen

ATP6V0D1 (NP_004682, 238aa-308aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLN

Conjugate

Product Categories/Family for anti-ATP6V0D1 antibody

Antibodies; Enzymes; ATPase

Applications Tested/Suitable for anti-ATP6V0D1 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-ATP6V0D1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-ATP6V0D1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for ATP6V0D1. It may not necessarily be applicable to this product.

NCBI GI #

19913432

NCBI GeneID

9114

NCBI Accession #

NP_004682

UniProt Primary Accession #

P61421

UniProt Secondary Accession #

P12953; Q02547

UniProt Related Accession #

P61421

GenBank Nucleotide #

NM_004691

NCBI Official Full Name

V-type proton ATPase subunit d 1

NCBI Official Synonym Full Names

ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1

NCBI Official Symbol

ATP6V0D1

NCBI Official Synonym Symbols

P39; VATX; VMA6; ATP6D; ATP6DV; VPATPD

UniProt Protein Name

V-type proton ATPase subunit d 1

UniProt Synonym Protein Names

32 kDa accessory protein; V-ATPase 40 kDa accessory protein; V-ATPase AC39 subunit; p39; Vacuolar proton pump subunit d 1

Protein Family

V-type proton ATPase

UniProt Gene Name

ATP6V0D1

UniProt Synonym Gene Names

ATP6D; VPATPD; V-ATPase subunit d 1; p39

UniProt Entry Name

VA0D1_HUMAN

NCBI Protein Information

V-type proton ATPase subunit d 1; 32 kDa accessory protein; ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D; H(+)-transporting two-sector ATPase, subunit D; V-ATPase 40 KDa accessory protein; V-ATPase AC39 subunit; V-ATPase subunit d 1

UniProt Comments for ATP6V0D1

ATP6V0D1: Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis. Belongs to the V-ATPase V0D/AC39 subunit family.

Protein type: Hydrolase; Vesicle; EC 3.6.3.14; Energy Metabolism - oxidative phosphorylation

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: centrosome; phagocytic vesicle membrane; synaptic vesicle; membrane; lysosomal membrane; apical plasma membrane; early endosome; endosome membrane; vacuolar proton-transporting V-type ATPase complex; nerve terminal

Molecular Function: hydrogen-exporting ATPase activity, phosphorylative mechanism; protein binding; protein complex binding

Biological Process: interaction with host; proton transport; cellular protein metabolic process; unfolded protein response, activation of signaling protein activity; unfolded protein response; cellular iron ion homeostasis; ATP hydrolysis coupled proton transport; insulin receptor signaling pathway; transferrin transport; cilium biogenesis; brain development; transmembrane transport

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ATP6V0D1 antibody

Reference Product	PubMed Publications
ATP6V0A2 antibody	>1 publications with ATP6V0D1 and ATP6V0A2
ATP6V1G1 antibody	>1 publications with ATP6V0D1 and ATP6V1G1
ATP6V0A1 antibody	>1 publications with ATP6V0D1 and ATP6V0A1
ATP6V1B1 antibody	>1 publications with ATP6V0D1 and ATP6V1B1
ATP6V0C antibody	>1 publications with ATP6V0D1 and ATP6V0C
ATP6V1F antibody	>1 publications with ATP6V0D1 and ATP6V1F
ATP6V1A antibody	>1 publications with ATP6V0D1 and ATP6V1A
ATP6V1B2 antibody	>1 publications with ATP6V0D1 and ATP6V1B2

Pathways associated with anti-ATP6V0D1 antibody

Products by Pathway	Pathway Diagram
Collecting Duct Acid Secretion Pathway antibodies	Collecting Duct Acid Secretion Pathway Diagram
Collecting Duct Acid Secretion Pathway antibodies	Collecting Duct Acid Secretion Pathway Diagram
Disease Pathway antibodies	Disease Pathway Diagram
Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway antibodies	Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway Diagram
Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway antibodies	Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway Diagram
IRE1alpha Activates Chaperones Pathway antibodies	IRE1alpha Activates Chaperones Pathway Diagram
Insulin Receptor Recycling Pathway antibodies	Insulin Receptor Recycling Pathway Diagram
Iron Uptake And Transport Pathway antibodies	Iron Uptake And Transport Pathway Diagram
Latent Infection Of Homo Sapiens With Mycobacterium Tuberculosis Pathway antibodies	Latent Infection Of Homo Sapiens With Mycobacterium Tuberculosis Pathway Diagram
Lysosome Pathway antibodies	Lysosome Pathway Diagram

Diseases associated with anti-ATP6V0D1 antibody

Disease Name	Pubmed Publications
Eye Abnormalities Antibodies	>1 publications with ATP6V0D1 and Eye Abnormalities
Congenital Abnormalities Antibodies	>1 publications with ATP6V0D1 and Congenital Abnormalities

Organs/Tissues associated with anti-ATP6V0D1 antibody

Organ/Tissue Name	Pubmed Publications
Bone Antibodies	>3 publications with ATP6V0D1 and Bone
Brain Antibodies	>2 publications with ATP6V0D1 and Brain
Connective Tissue Antibodies	>1 publications with ATP6V0D1 and Connective Tissue
Adrenal Gland Antibodies	>1 publications with ATP6V0D1 and Adrenal Gland
Muscle Antibodies	>1 publications with ATP6V0D1 and Muscle
Bone Marrow Antibodies	>1 publications with ATP6V0D1 and Bone Marrow
Heart Antibodies	>1 publications with ATP6V0D1 and Heart
Eye Antibodies	>1 publications with ATP6V0D1 and Eye
Epididymis Antibodies	>1 publications with ATP6V0D1 and Epididymis
Embryonic Tissue Antibodies	>1 publications with ATP6V0D1 and Embryonic Tissue