Mouse Anti-SAP30 Monoclonal Antibody – Cat# MBS6165122

SAP30 Antibody – Mouse Monoclonal

Name: SAP30 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6165122
Price: 995 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6165122

Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which… More details

$995 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

SAP30, Monoclonal Antibody

Full Product Name

SAP30 (Sin3A-Associated Protein, 30kD) (AP)

Product Gene Name

anti-SAP30 antibody

Product Synonym Names

Sin3A-Associated Protein; 30kD

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

1D3

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

Purity/Purification

Purified

Specificity

Recognizes SAP30.

Preparation and Storage

Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

23kDa

OMIM

603378

3D Structure

ModBase 3D Structure for O75446

Immunogen

SAP30 (NP_003855, 131aa-219aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

SDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGV

Conjugate

Product Categories/Family for anti-SAP30 antibody

Antibodies; Transcription Factors

Applications Tested/Suitable for anti-SAP30 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-SAP30 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-SAP30 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SAP30 purchase

MBS6165122 is an antibody targeting SAP30. Also known as SAP30 (Sin3A-Associated Protein, 30kD) (AP). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for SAP30. It may not necessarily be applicable to this product.

NCBI GI #

4506783

NCBI GeneID

8819

NCBI Accession #

NP_003855

UniProt Primary Accession #

O75446

UniProt Related Accession #

O75446

GenBank Nucleotide #

NM_003864

NCBI Official Full Name

histone deacetylase complex subunit SAP30

NCBI Official Synonym Full Names

Sin3A associated protein 30

NCBI Official Symbol

SAP30

UniProt Protein Name

Histone deacetylase complex subunit SAP30

UniProt Synonym Protein Names

30 kDa Sin3-associated polypeptide; Sin3 corepressor complex subunit SAP30; Sin3-associated polypeptide p30

Protein Family

Histone deacetylase complex

UniProt Gene Name

SAP30

UniProt Entry Name

SAP30_HUMAN

NCBI Protein Information

histone deacetylase complex subunit SAP30

UniProt Comments for SAP30

SAP30: Involved in the functional recruitment of the Sin3- histone deacetylase complex (HDAC) to a specific subset of N-CoR corepressor complexes. Capable of transcription repression by N- CoR. Active in deacetylating core histone octamers (when in a complex) but inactive in deacetylating nucleosomal histones. Belongs to the SAP30 family.

Protein type: Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 4q34.1

Cellular Component: nucleoplasm; histone deacetylase complex

Molecular Function: protein binding; DNA binding; metal ion binding; transcription corepressor activity

Biological Process: establishment and/or maintenance of chromatin architecture; regulation of transcription, DNA-dependent; transcription, DNA-dependent; negative regulation of gene expression, epigenetic; gene expression; negative regulation of transcription from RNA polymerase II promoter; regulation of gene expression, epigenetic

Research Articles on SAP30

1. upregulation of NETO2 gene is first stipulated by the isoform 1 (NM_018092.4), and the probable mechanism of its activation is associated with the increased expression of SAP30 transcription factor.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-SAP30 antibody

Reference Product	PubMed Publications
HDAC1 antibody	>10 publications with SAP30 and HDAC1
SIN3A antibody	>6 publications with SAP30 and SIN3A
HDAC2 antibody	>6 publications with SAP30 and HDAC2
SAP30BP antibody	>4 publications with SAP30 and SAP30BP
RBP1 antibody	>3 publications with SAP30 and RBP1
ING1 antibody	>3 publications with SAP30 and ING1
YY1 antibody	>2 publications with SAP30 and YY1
NCOR1 antibody	>2 publications with SAP30 and NCOR1
RBBP7 antibody	>1 publications with SAP30 and RBBP7
RBBP4 antibody	>1 publications with SAP30 and RBBP4

Pathways associated with anti-SAP30 antibody

Products by Pathway	Pathway Diagram
Delta-Notch Signaling Pathway antibodies	Delta-Notch Signaling Pathway Diagram
Hedgehog Signaling Events Mediated By Gli Proteins Pathway antibodies	Hedgehog Signaling Events Mediated By Gli Proteins Pathway Diagram
Regulation Of Telomerase Pathway antibodies	Regulation Of Telomerase Pathway Diagram
Regulation Of Nuclear SMAD2/3 Signaling Pathway antibodies	Regulation Of Nuclear SMAD2/3 Signaling Pathway Diagram
Signaling Events Mediated By HDAC Class I Pathway antibodies	Signaling Events Mediated By HDAC Class I Pathway Diagram

Diseases associated with anti-SAP30 antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>6 publications with SAP30 and Neoplasms
Carcinoma Antibodies	>4 publications with SAP30 and Carcinoma
Skin Neoplasms Antibodies	>3 publications with SAP30 and Skin Neoplasms
Carcinoma, Squamous Cell Antibodies	>2 publications with SAP30 and Carcinoma, Squamous Cell
Head and Neck Neoplasms Antibodies	>1 publications with SAP30 and Head and Neck Neoplasms
Fetal Death Antibodies	>1 publications with SAP30 and Fetal Death
Cell Transformation, Neoplastic Antibodies	>1 publications with SAP30 and Cell Transformation, Neoplastic

Organs/Tissues associated with anti-SAP30 antibody

Organ/Tissue Name	Pubmed Publications
Skin Antibodies	>3 publications with SAP30 and Skin
Brain Antibodies	>3 publications with SAP30 and Brain
Pancreas Antibodies	>1 publications with SAP30 and Pancreas
Heart Antibodies	>1 publications with SAP30 and Heart
Blood Antibodies	>1 publications with SAP30 and Blood
Kidney Antibodies	>1 publications with SAP30 and Kidney
Intestine Antibodies	>1 publications with SAP30 and Intestine
Embryonic Tissue Antibodies	>1 publications with SAP30 and Embryonic Tissue
Mammary Gland Antibodies	>1 publications with SAP30 and Mammary Gland
Lung Antibodies	>1 publications with SAP30 and Lung