• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

TNFRSF25 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6165160

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed preferentially in the tissues enriched in lymphocytes, and it may play a role in regulating lymphocyte homeostasis. This receptor has been shown to… More details

$995 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
TNFRSF25, Monoclonal Antibody
Full Product Name
TNFRSF25 (Tumor Necrosis Factor Receptor Superfamily, Member 25, APO-3, DDR3, DR3, LARD, TNFRSF12, TR3, TRAMP, WSL-1, WSL-LR) (AP)
Product Gene Name
anti-TNFRSF25 antibody
Product Synonym Names
Tumor Necrosis Factor Receptor Superfamily; Member 25; APO-3; DDR3; DR3; LARD; TNFRSF12; TR3; TRAMP; WSL-1; WSL-LR
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H2
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Purity/Purification
Purified
Specificity
Recognizes TNFRSF25.
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
46.1kDa (417aa) 40-57KDa (SDS-PAGE under reducing conditions.)
OMIM
603366
3D Structure
ModBase 3D Structure for Q93038
Immunogen
TNFRSF25 (NP_003781, 28aa-124aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVE
Conjugate
AP

Product Categories/Family for anti-TNFRSF25 antibody

Antibodies; Growth Factors; Cytokines
Applications Tested/Suitable for anti-TNFRSF25 antibody
Western Blot (WB)
Application Notes for anti-TNFRSF25 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-TNFRSF25 antibody

TNFRSF25 monoclonal antibody (M07), clone 1H2. Western Blot analysis of TNFRSF25 expression in K-562.
Mouse Anti-TNFRSF25 Monoclonal Antibody – Cat# MBS6165160

Testing Data of anti-TNFRSF25 antibody

Detection limit for recombinant GST tagged TNFRSF25 is 0.03 ng/ml as a capture antibody.
Mouse Anti-TNFRSF25 Monoclonal Antibody, Testing Data – Cat# MBS6165160

Other Notes

Small volumes of anti-TNFRSF25 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for TNFRSF25 purchase

MBS6165160 is an antibody targeting TNFRSF25. Also known as TNFRSF25 (Tumor Necrosis Factor Receptor Superfamily, Member 25, APO-3, DDR3, DR3, LARD, TNFRSF12, TR3, TRAMP, WSL-1, WSL-LR) (AP). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for TNFRSF25. It may not necessarily be applicable to this product.

NCBI GI #
4507569
NCBI GeneID
8718
NCBI Accession #
NP_003781
UniProt Primary Accession #
Q93038
UniProt Secondary Accession #
O00275; O00276; O00277; O00278; O00279; O00280; O14865; O14866; B1ALX2; B1ALX3; B7ZLL7
UniProt Related Accession #
Q93038
GenBank Nucleotide #
NM_003790.2
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 25 isoform 2
NCBI Official Synonym Full Names
TNF receptor superfamily member 25
NCBI Official Symbol
TNFRSF25
NCBI Official Synonym Symbols
DR3; TR3; DDR3; LARD; APO-3; TRAMP; WSL-1; WSL-LR; TNFRSF12
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 25
UniProt Synonym Protein Names
Apo-3; Apoptosis-inducing receptor AIR; Apoptosis-mediating receptor DR3; Apoptosis-mediating receptor TRAMP; Death receptor 3; Lymphocyte-associated receptor of death; LARD; Protein WSL; Protein WSL-1
Protein Family
Tumor necrosis factor receptor superfamily
UniProt Gene Name
TNFRSF25
UniProt Synonym Gene Names
APO3; DDR3; DR3; TNFRSF12; WSL; WSL1; LARD
UniProt Entry Name
TNR25_HUMAN
NCBI Protein Information
tumor necrosis factor receptor superfamily member 25

UniProt Comments for TNFRSF25

TNFRSF25: Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis. Homodimer. Interacts strongly via the death domains with TNFRSF1 and TRADD to activate at least two distinct signaling cascades, apoptosis and NF-kappa-B signaling. Interacts with BAG4. Abundantly expressed in thymocytes and lymphocytes. Detected in lymphocyte-rich tissues such as thymus, colon, intestine, and spleen. Also found in the prostate. 12 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Apoptosis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p36.2

Cellular Component: integral to plasma membrane; plasma membrane; extracellular region; cytosol

Molecular Function: tumor necrosis factor receptor activity; receptor activity

Biological Process: regulation of apoptosis; cell surface receptor linked signal transduction; tumor necrosis factor-mediated signaling pathway; apoptosis; signal transduction
Show more

Research Articles on TNFRSF25

1. the DR3/TL1A pathway directly enhances human OC formation and resorptive activity, controlling expression and activation of CCL3 and MMP-9.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-TNFRSF25 antibody

 Products by Pathway  Pathway Diagram
 Apoptosis Pathway antibodies  Apoptosis Pathway Diagram
 Apoptosis Modulation And Signaling Pathway antibodies  Apoptosis Modulation And Signaling Pathway Diagram
 Cytokine Signaling In Immune System Pathway antibodies  Cytokine Signaling In Immune System Pathway Diagram
 Cytokine-cytokine Receptor Interaction Pathway antibodies  Cytokine-cytokine Receptor Interaction Pathway Diagram
 Cytokine-cytokine Receptor Interaction Pathway antibodies  Cytokine-cytokine Receptor Interaction Pathway Diagram
 Immune System Pathway antibodies  Immune System Pathway Diagram
 TNFR2 Non-canonical NF-kB Pathway antibodies  TNFR2 Non-canonical NF-kB Pathway Diagram
 TNFs Bind Their Physiological Receptors Pathway antibodies  TNFs Bind Their Physiological Receptors Pathway Diagram

Diseases associated with anti-TNFRSF25 antibody

 Disease Name  Pubmed Publications
 Necrosis Antibodies  >177 publications with TNFRSF25 and Necrosis
 Prostatic Neoplasms Antibodies  >28 publications with TNFRSF25 and Prostatic Neoplasms
 Inflammation Antibodies  >28 publications with TNFRSF25 and Inflammation
 Disease Models, Animal Antibodies  >22 publications with TNFRSF25 and Disease Models, Animal
 Respiratory Tract Diseases Antibodies  >13 publications with TNFRSF25 and Respiratory Tract Diseases
 Nervous System Diseases Antibodies  >13 publications with TNFRSF25 and Nervous System Diseases
 Neoplasms, Experimental Antibodies  >7 publications with TNFRSF25 and Neoplasms, Experimental
 Neoplasm Metastasis Antibodies  >7 publications with TNFRSF25 and Neoplasm Metastasis
 Kidney Diseases Antibodies  >6 publications with TNFRSF25 and Kidney Diseases
 Liver Diseases Antibodies  >6 publications with TNFRSF25 and Liver Diseases

Organs/Tissues associated with anti-TNFRSF25 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >72 publications with TNFRSF25 and Blood
 Lung Antibodies  >13 publications with TNFRSF25 and Lung
 Intestine Antibodies  >10 publications with TNFRSF25 and Intestine
 Skin Antibodies  >9 publications with TNFRSF25 and Skin
 Spleen Antibodies  >7 publications with TNFRSF25 and Spleen
 Brain Antibodies  >7 publications with TNFRSF25 and Brain
 Heart Antibodies  >5 publications with TNFRSF25 and Heart
 Eye Antibodies  >5 publications with TNFRSF25 and Eye
 Thymus Antibodies  >4 publications with TNFRSF25 and Thymus
 Connective Tissue Antibodies  >4 publications with TNFRSF25 and Connective Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000