• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

SNRPB Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6165254

The protein encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role… More details

$995 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
SNRPB, Monoclonal Antibody
Full Product Name
SNRPB (Small Nuclear Ribonucleoprotein Polypeptides B and B1, COD, SNRPB1, SmB/SmB', snRNP-B) (AP)
Product Gene Name
anti-SNRPB antibody
Product Synonym Names
Small Nuclear Ribonucleoprotein Polypeptides B and B1; COD; SNRPB1; SmB/SmB'; snRNP-B
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B4
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Purity/Purification
Purified
Specificity
Recognizes SNRPB.
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
30,032 Da
OMIM
182282
3D Structure
ModBase 3D Structure for P14678
Immunogen
SNRPB (NP_003082, 1aa-80aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
Conjugate
AP

Product Categories/Family for anti-SNRPB antibody

Antibodies; Nuclear Proteins
Applications Tested/Suitable for anti-SNRPB antibody
ELISA (EIA)
Application Notes for anti-SNRPB antibody
Applications are based on unconjugated antibody.

Testing Data of anti-SNRPB antibody

Detection limit for recombinant GST tagged SNRPB is 3 ng/ml as a capture antibody.
Mouse Anti-SNRPB Monoclonal Antibody – Cat# MBS6165254

Other Notes

Small volumes of anti-SNRPB antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SNRPB purchase

MBS6165254 is an antibody targeting SNRPB. Also known as SNRPB (Small Nuclear Ribonucleoprotein Polypeptides B and B1, COD, SNRPB1, SmB/SmB', snRNP-B) (AP). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for SNRPB. It may not necessarily be applicable to this product.

NCBI GI #
4507125
NCBI GeneID
6628
NCBI Accession #
NP_003082
UniProt Primary Accession #
P14678
UniProt Secondary Accession #
Q15490; Q6IB35; Q9UIS5
UniProt Related Accession #
P14678
GenBank Nucleotide #
NM_003091
NCBI Official Full Name
small nuclear ribonucleoprotein-associated proteins B and B' isoform B
NCBI Official Synonym Full Names
small nuclear ribonucleoprotein polypeptides B and B1
NCBI Official Symbol
SNRPB
NCBI Official Synonym Symbols
COD; SNRPB1; SmB/B'; Sm-B/B'; snRNP-B; SmB/SmB'
UniProt Protein Name
Small nuclear ribonucleoprotein-associated proteins B and B'
UniProt Synonym Protein Names
Sm protein B/B'; Sm-B/B'; SmB/B'
Protein Family
Small nuclear ribonucleoprotein-associated protein
UniProt Gene Name
SNRPB
UniProt Synonym Gene Names
COD; SNRPB1; snRNP-B; Sm-B/B'; SmB/B'
UniProt Entry Name
RSMB_HUMAN
NCBI Protein Information
small nuclear ribonucleoprotein-associated proteins B and B'; B polypeptide of Sm protein; Sm protein B/B'; sm-B/Sm-B'; small nuclear ribonucleoprotein polypeptide B; small nuclear ribonucleoprotein polypeptides B and B'

UniProt Comments for SNRPB

snRNP B1: Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5. May have a functional role in the pre-mRNA splicing or in snRNP structure. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner. Belongs to the snRNP SmB/SmN family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA splicing; Spliceosome; RNA-binding; RNA processing

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: small nuclear ribonucleoprotein complex; nucleoplasm; spliceosome; snRNP U1; cytosol; U12-dependent spliceosome

Molecular Function: protein binding

Biological Process: transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome; spliceosomal snRNP biogenesis; RNA splicing; histone mRNA metabolic process; gene expression; mRNA 3'-end processing; termination of RNA polymerase II transcription
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-SNRPB antibody

 Reference Product  PubMed Publications
 SNRPE antibody  >51 publications with SNRPB and SNRPE
 SNRPF antibody  >50 publications with SNRPB and SNRPF
 SNRPD1 antibody  >5 publications with SNRPB and SNRPD1
 SNRPD3 antibody  >4 publications with SNRPB and SNRPD3

Pathways associated with anti-SNRPB antibody

 Products by Pathway  Pathway Diagram
 Cleavage Of Growing Transcript In The Termination Region Pathway antibodies  Cleavage Of Growing Transcript In The Termination Region Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 Metabolism Of Non-coding RNA Pathway antibodies  Metabolism Of Non-coding RNA Pathway Diagram
 Processing Of Capped Intron-Containing Pre-mRNA Pathway antibodies  Processing Of Capped Intron-Containing Pre-mRNA Pathway Diagram
 Processing Of Capped Intronless Pre-mRNA Pathway antibodies  Processing Of Capped Intronless Pre-mRNA Pathway Diagram
 RNA Polymerase II Transcription Pathway antibodies  RNA Polymerase II Transcription Pathway Diagram
 RNA Polymerase II Transcription Termination Pathway antibodies  RNA Polymerase II Transcription Termination Pathway Diagram
 SLBP Dependent Processing Of Replication-Dependent Histone Pre-mRNAs Pathway antibodies  SLBP Dependent Processing Of Replication-Dependent Histone Pre-mRNAs Pathway Diagram
 SLBP Independent Processing Of Histone Pre-mRNAs Pathway antibodies  SLBP Independent Processing Of Histone Pre-mRNAs Pathway Diagram
 Sm Core Complex Pathway antibodies  Sm Core Complex Pathway Diagram

Diseases associated with anti-SNRPB antibody

 Disease Name  Pubmed Publications
 Skin Diseases Antibodies  >2 publications with SNRPB and Skin Diseases
 Nervous System Diseases Antibodies  >2 publications with SNRPB and Nervous System Diseases
 Breast Neoplasms Antibodies  >1 publications with SNRPB and Breast Neoplasms
 Disease Models, Animal Antibodies  >1 publications with SNRPB and Disease Models, Animal

Organs/Tissues associated with anti-SNRPB antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >15 publications with SNRPB and Blood
 Brain Antibodies  >9 publications with SNRPB and Brain
 Nerve Antibodies  >6 publications with SNRPB and Nerve
 Heart Antibodies  >6 publications with SNRPB and Heart
 Spleen Antibodies  >5 publications with SNRPB and Spleen
 Connective Tissue Antibodies  >2 publications with SNRPB and Connective Tissue
 Muscle Antibodies  >2 publications with SNRPB and Muscle
 Embryonic Tissue Antibodies  >2 publications with SNRPB and Embryonic Tissue
 Lymph Antibodies  >1 publications with SNRPB and Lymph
 Lymph Node Antibodies  >1 publications with SNRPB and Lymph Node
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000