• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

HEY2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6165256

This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The encoded protein forms homo- or hetero-dimers that localize to the nucleus and interact with a histone… More details

$995 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
HEY2, Monoclonal Antibody
Full Product Name
HEY2 (Hairy/Enhancer-of-Split Related with YRPW Motif 2, CHF1, GRIDLOCK, GRL, HERP1, HESR2, HRT2, MGC10720, bHLHb32) (AP)
Product Gene Name
anti-HEY2 antibody
Product Synonym Names
Hairy/Enhancer-of-Split Related with YRPW Motif 2; CHF1; GRIDLOCK; GRL; HERP1; HESR2; HRT2; MGC10720; bHLHb32
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B10
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Purity/Purification
Purified
Specificity
Recognizes HEY2.
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Chromosome Location
Chromosome: 6; NC_000006.11 (126070732..126082415). Location: 6q21
OMIM
604674
3D Structure
ModBase 3D Structure for Q9UBP5
Immunogen
HEY2 (NP_036391.1, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKG
Conjugate
AP

Product Categories/Family for anti-HEY2 antibody

Antibodies; Transcription Factors
Applications Tested/Suitable for anti-HEY2 antibody
Western Blot (WB)
Application Notes for anti-HEY2 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-HEY2 antibody

HEY2 monoclonal antibody (M02), clone 2B10. Western Blot analysis of HEY2 expression in human pancreas.
Mouse Anti-HEY2 Monoclonal Antibody – Cat# MBS6165256

Testing Data of anti-HEY2 antibody

Detection limit for recombinant GST tagged HEY2 is 3 ng/ml as a capture antibody.
Mouse Anti-HEY2 Monoclonal Antibody, Testing Data – Cat# MBS6165256

Other Notes

Small volumes of anti-HEY2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for HEY2 purchase

MBS6165256 is an antibody targeting HEY2. Also known as HEY2 (Hairy/Enhancer-of-Split Related with YRPW Motif 2, CHF1, GRIDLOCK, GRL, HERP1, HESR2, HRT2, MGC10720, bHLHb32) (AP). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for HEY2. It may not necessarily be applicable to this product.

NCBI GI #
6912414
NCBI GeneID
23493
NCBI Accession #
NP_036391.1
UniProt Primary Accession #
Q9UBP5
UniProt Related Accession #
Q9UBP5
GenBank Nucleotide #
NM_012259.2
NCBI Official Full Name
hairy/enhancer-of-split related with YRPW motif protein 2
NCBI Official Synonym Full Names
hairy/enhancer-of-split related with YRPW motif 2
NCBI Official Symbol
HEY2
NCBI Official Synonym Symbols
GRL; CHF1; HRT2; HERP1; HESR2; bHLHb32; GRIDLOCK
UniProt Protein Name
Hairy/enhancer-of-split related with YRPW motif protein 2
UniProt Synonym Protein Names
Cardiovascular helix-loop-helix factor 1; hCHF1; Class B basic helix-loop-helix protein 32; bHLHb32; HES-related repressor protein 2; Hairy and enhancer of split-related protein 2; HESR-2; Hairy-related transcription factor 2; HRT-2; hHRT2; Protein gridlock homolog
Protein Family
Hairy/enhancer-of-split related with YRPW motif protein
UniProt Gene Name
HEY2
UniProt Synonym Gene Names
BHLHB32; CHF1; GRL; HERP; HERP1; HRT2; hCHF1; bHLHb32; HESR-2; HRT-2; hHRT2
UniProt Entry Name
HEY2_HUMAN
NCBI Protein Information
hairy/enhancer-of-split related with YRPW motif protein 2; HRT-2; hCHF1; hHRT2; HESR-2; protein gridlock homolog; HES-related repressor protein 1; HES-related repressor protein 2; hairy-related transcription factor 2; cardiovascular helix-loop-helix facto

UniProt Comments for HEY2

HEY2: Downstream effector of Notch signaling which may be required for cardiovascular development. Transcriptional repressor which binds preferentially to the canonical E box sequence 5'- CACGTG-3'. Represses transcription by the cardiac transcriptional activators GATA4 and GATA6. Belongs to the HEY family.

Chromosomal Location of Human Ortholog: 6q21

Cellular Component: nucleoplasm; Sin3 complex; transcriptional repressor complex; cytoplasm; nucleus

Molecular Function: protein dimerization activity; protein binding; sequence-specific DNA binding; histone deacetylase binding; transcription factor activity; transcription factor binding

Biological Process: cardiac muscle hypertrophy; transcription from RNA polymerase II promoter; Notch signaling pathway; cell fate commitment; ventricular cardiac muscle cell development; positive regulation of heart rate; negative regulation of transcription from RNA polymerase II promoter; protein-DNA complex assembly; regulation of auditory receptor cell differentiation; negative regulation of Notch signaling pathway; smooth muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; vasculogenesis; mesenchymal cell development; anterior/posterior axis specification; positive regulation of cardiac muscle cell proliferation
Show more

Research Articles on HEY2

1. Report down-regulation of Notch signaling components NOTCH3 and HEY2 in abdominal aortic aneurysms.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-HEY2 antibody

 Reference Product  PubMed Publications
 SIRT1 antibody  >2 publications with HEY2 and SIRT1
 HAND2 antibody  >2 publications with HEY2 and HAND2
 HDAC1 antibody  >1 publications with HEY2 and HDAC1
 ARNT antibody  >1 publications with HEY2 and ARNT

Pathways associated with anti-HEY2 antibody

 Products by Pathway  Pathway Diagram
 Constitutive Signaling By NOTCH1 PEST Domain Mutants Pathway antibodies  Constitutive Signaling By NOTCH1 PEST Domain Mutants Pathway Diagram
 Delta-Notch Signaling Pathway antibodies  Delta-Notch Signaling Pathway Diagram
 Disease Pathway antibodies  Disease Pathway Diagram
 FBXW7 Mutants And NOTCH1 In Cancer Pathway antibodies  FBXW7 Mutants And NOTCH1 In Cancer Pathway Diagram
 Heart Development Pathway antibodies  Heart Development Pathway Diagram
 NOTCH1 Intracellular Domain Regulates Transcription Pathway antibodies  NOTCH1 Intracellular Domain Regulates Transcription Pathway Diagram
 Neural Crest Differentiation Pathway antibodies  Neural Crest Differentiation Pathway Diagram
 Notch-mediated HES/HEY Network Pathway antibodies  Notch-mediated HES/HEY Network Pathway Diagram
 Signal Transduction Pathway antibodies  Signal Transduction Pathway Diagram
 Signaling By NOTCH Pathway antibodies  Signaling By NOTCH Pathway Diagram

Diseases associated with anti-HEY2 antibody

 Disease Name  Pubmed Publications
 Congenital Abnormalities Antibodies  >22 publications with HEY2 and Congenital Abnormalities
 Heart Defects, Congenital Antibodies  >21 publications with HEY2 and Heart Defects, Congenital
 Neoplasms Antibodies  >18 publications with HEY2 and Neoplasms
 Hypertrophy Antibodies  >10 publications with HEY2 and Hypertrophy
 Disease Models, Animal Antibodies  >8 publications with HEY2 and Disease Models, Animal
 Fibrosis Antibodies  >6 publications with HEY2 and Fibrosis
 Nervous System Diseases Antibodies  >4 publications with HEY2 and Nervous System Diseases
 Lung Diseases Antibodies  >3 publications with HEY2 and Lung Diseases
 Immune System Diseases Antibodies  >3 publications with HEY2 and Immune System Diseases
 Necrosis Antibodies  >2 publications with HEY2 and Necrosis

Organs/Tissues associated with anti-HEY2 antibody

 Organ/Tissue Name  Pubmed Publications
 Vascular Antibodies  >53 publications with HEY2 and Vascular
 Muscle Antibodies  >33 publications with HEY2 and Muscle
 Brain Antibodies  >13 publications with HEY2 and Brain
 Lung Antibodies  >11 publications with HEY2 and Lung
 Bone Antibodies  >11 publications with HEY2 and Bone
 Eye Antibodies  >10 publications with HEY2 and Eye
 Liver Antibodies  >5 publications with HEY2 and Liver
 Ovary Antibodies  >3 publications with HEY2 and Ovary
 Uterus Antibodies  >1 publications with HEY2 and Uterus
 Placenta Antibodies  >1 publications with HEY2 and Placenta
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000