Mouse Anti-LRRC8A Monoclonal Antibody – Cat# MBS6165725

LRRC8A monoclonal antibody (M04), clone 8H9. Western Blot analysis of LRRC8A expression in A-431.

LRRC8A Antibody – Mouse Monoclonal

Name: LRRC8A Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6165725
Price: 995 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6165725

This gene encodes a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. This family member is a putative… More details

$995 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

LRRC8A, Monoclonal Antibody

Full Product Name

LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A, FLJ10337, FLJ41617, KIAA1437, LRRC8) (AP)

Product Gene Name

anti-LRRC8A antibody

Product Synonym Names

Leucine Rich Repeat Containing 8 Family; Member A; FLJ10337; FLJ41617; KIAA1437; LRRC8

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

8H9

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

Purity/Purification

Purified

Specificity

Recognizes LRRC8A.

Preparation and Storage

Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

608360

3D Structure

ModBase 3D Structure for Q8IWT6

Immunogen

LRRC8A (NP_062540.2, 711aa-810aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

QNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA

Conjugate

Product Categories/Family for anti-LRRC8A antibody

Antibodies; Leucine-rich Proteins

Applications Tested/Suitable for anti-LRRC8A antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-LRRC8A antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-LRRC8A antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for LRRC8A purchase

MBS6165725 is an antibody targeting LRRC8A. Also known as LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A, FLJ10337, FLJ41617, KIAA1437, LRRC8) (AP). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for LRRC8A. It may not necessarily be applicable to this product.

NCBI GI #

62241040

NCBI Accession #

NP_062540.2

UniProt Primary Accession #

Q8IWT6

GenBank Nucleotide #

NP_062540.2

NCBI Official Full Name

volume-regulated anion channel subunit LRRC8A

UniProt Protein Name

Volume-regulated anion channel subunit LRRC8A

UniProt Synonym Protein Names

Leucine-rich repeat-containing protein 8A; Swelling protein 1

Protein Family

Volume-regulated anion channel

UniProt Gene Name

LRRC8A

UniProt Synonym Gene Names

KIAA1437; LRRC8; SWELL1

UniProt Entry Name

LRC8A_HUMAN

UniProt Comments for LRRC8A

LRRC8A: Involved in B-cell development. Required for the pro-B cell to pre-B cell transition. Defects in LRRC8A are the cause of agammaglobulinemia type 5 (AGM5). It is a primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B-cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life. A chromosomal aberration involving LRRC8 has been found in a patient with congenital agammaglobulinemia. Translocation t(9;20)(q33.2;q12). The translocation truncates the LRRC8 gene, resulting in deletion of the eighth, ninth, and half of the seventh LRR domains.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 9q34.11

Cellular Component: cell surface; membrane; plasma membrane

Molecular Function: anion channel activity; protein binding; volume-sensitive anion channel activity

Biological Process: anion transport; cell volume homeostasis; pre-B cell differentiation; response to osmotic stress

Disease: Agammaglobulinemia 5, Autosomal Dominant

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-LRRC8A antibody

Disease Name	Pubmed Publications
Agammaglobulinemia Antibodies	>3 publications with LRRC8A and Agammaglobulinemia
Diabetes Mellitus Antibodies	>2 publications with LRRC8A and Diabetes Mellitus
Immune System Diseases Antibodies	>2 publications with LRRC8A and Immune System Diseases
Abnormalities, Multiple Antibodies	>1 publications with LRRC8A and Abnormalities, Multiple
Edema Antibodies	>1 publications with LRRC8A and Edema
Lung Neoplasms Antibodies	>1 publications with LRRC8A and Lung Neoplasms
Necrosis Antibodies	>1 publications with LRRC8A and Necrosis

Organs/Tissues associated with anti-LRRC8A antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>6 publications with LRRC8A and Blood
Lung Antibodies	>4 publications with LRRC8A and Lung
Nerve Antibodies	>3 publications with LRRC8A and Nerve
Brain Antibodies	>3 publications with LRRC8A and Brain
Bone Antibodies	>1 publications with LRRC8A and Bone
Skin Antibodies	>1 publications with LRRC8A and Skin
Bone Marrow Antibodies	>1 publications with LRRC8A and Bone Marrow
Placenta Antibodies	>1 publications with LRRC8A and Placenta
Embryonic Tissue Antibodies	>1 publications with LRRC8A and Embryonic Tissue
Eye Antibodies	>1 publications with LRRC8A and Eye