• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

MYC Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6166572

The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes.… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
MYC, Monoclonal Antibody
Full Product Name
MYC (V-myc Myelocytomatosis Viral Oncogene Homolog (avian), bHLHe39, c-Myc) (APC)
Product Gene Name
anti-MYC antibody
Product Synonym Names
V-myc Myelocytomatosis Viral Oncogene Homolog (avian); bHLHe39; c-Myc
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1G7
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified
Specificity
Recognizes MYC.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
50,565 Da
OMIM
113970
3D Structure
ModBase 3D Structure for P01106
Immunogen
MYC (NP_002458, 330aa-439aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
Conjugate
APC

Product Categories/Family for anti-MYC antibody

Antibodies; Transcription Factors
Applications Tested/Suitable for anti-MYC antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-MYC antibody
Applications are based on unconjugated antibody.

Testing Data of anti-MYC antibody

Immunoperoxidase of monoclonal antibody to MYC on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Mouse Anti-MYC Monoclonal Antibody – Cat# MBS6166572

Immunohistochemistry (IHC) of anti-MYC antibody

Immunoperoxidase of monoclonal antibody to MYC on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Mouse Anti-MYC Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6166572

Western Blot (WB) of anti-MYC antibody

Western Blot analysis of MYC expression in transfected 293T cell line by MYC monoclonal antibody (M02), clone 1G7.

Lane 1: MYC transfected lysate(49.561 KDa).
Lane 2: Non-transfected lysate.
Mouse Anti-MYC Monoclonal Antibody, Western Blot (WB) – Cat# MBS6166572

Testing Data of anti-MYC antibody

HeLa cells were stained with MYC-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).
Mouse Anti-MYC Monoclonal Antibody, Testing Data – Cat# MBS6166572

Immunofluorescence (IF) of anti-MYC antibody

Immunofluorescence of monoclonal antibody to MYC on HeLa cell. [antibody concentration 10 ug/ml]
Mouse Anti-MYC Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6166572

Product References and Citations for anti-MYC antibody

1. From midbody protein-protein interaction network construction to novel regulators in cytokinesis. Chen TC, Lee SA, Hong TM, Shih JY, Lai JM, Chiou HY, Yang SC, Chan CH, Kao CY, Yang PC, Huang CY.J Proteome Res. 2009 Nov;8(11):4943-53.

Other Notes

Small volumes of anti-MYC antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MYC purchase

MBS6166572 is an antibody targeting MYC. Also known as MYC (V-myc Myelocytomatosis Viral Oncogene Homolog (avian), bHLHe39, c-Myc) (APC). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for MYC. It may not necessarily be applicable to this product.

NCBI GI #
71774083
NCBI GeneID
4609
NCBI Accession #
NP_002458
UniProt Primary Accession #
P01106
UniProt Secondary Accession #
P01107; Q14026; A8WFE7
UniProt Related Accession #
P01106
GenBank Nucleotide #
NM_002467.5
NCBI Official Full Name
myc proto-oncogene protein isoform 1
NCBI Official Synonym Full Names
MYC proto-oncogene, bHLH transcription factor
NCBI Official Symbol
MYC
NCBI Official Synonym Symbols
MRTL; MYCC; c-Myc; bHLHe39
UniProt Protein Name
Myc proto-oncogene protein
UniProt Synonym Protein Names
Class E basic helix-loop-helix protein 39; bHLHe39; Proto-oncogene c-Myc; Transcription factor p64
Protein Family
Myc protein
UniProt Gene Name
MYC
UniProt Synonym Gene Names
BHLHE39; bHLHe39
UniProt Entry Name
MYC_HUMAN
NCBI Protein Information
myc proto-oncogene protein

NCBI Summary for MYC

This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini. [provided by RefSeq, Aug 2017]
Show more

UniProt Comments for MYC

Myc: a proto-oncogenic transcription factor that plays a role in cell proliferation, apoptosis and in the development of human tumors. Seems to activate the transcription of growth-related genes.

Protein type: DNA-binding; Transcription factor; Oncoprotein; Nucleolus

Chromosomal Location of Human Ortholog: 8q24.21

Cellular Component: nucleoplasm; protein complex; nucleolus; nucleus; cytosol

Molecular Function: protein dimerization activity; protein binding; DNA binding; protein complex binding; transcription factor activity; transcription factor binding

Biological Process: oxygen transport; cellular iron ion homeostasis; positive regulation of transcription, DNA-dependent; positive regulation of caspase activity; Wnt receptor signaling pathway through beta-catenin; negative regulation of transcription from RNA polymerase II promoter; chromosome organization and biogenesis; positive regulation of fibroblast proliferation; transforming growth factor beta receptor signaling pathway; positive regulation of cell proliferation; positive regulation of mesenchymal cell proliferation; response to gamma radiation; cell cycle arrest; response to drug; transcription initiation from RNA polymerase II promoter; Notch signaling pathway; transcription, DNA-dependent; regulation of telomere maintenance; MAPKKK cascade; negative regulation of cell division; negative regulation of stress-activated MAPK cascade; negative regulation of monocyte differentiation; chromatin remodeling; ureteric bud branching; negative regulation of fibroblast proliferation; regulation of gene expression; energy reserve metabolic process; positive regulation of transcription from RNA polymerase II promoter; gene expression; response to DNA damage stimulus; positive regulation of epithelial cell proliferation; negative regulation of apoptosis

Disease: Burkitt Lymphoma
Show more

Research Articles on MYC

1. Further analysis indicated that JQ1 inhibited the recruitment of BDR4 to the promoter complex of the Myc and Ccnd1 genes in rat thyroid follicular PCCL3 cells, resulting in decreased MYC expression at the mRNA and protein levels to inhibit tumor cell proliferation

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-MYC antibody

 Reference Product  PubMed Publications
 MAX antibody  >920 publications with MYC and MAX
 CDKN1A antibody  >483 publications with MYC and CDKN1A
 CDKN2A antibody  >405 publications with MYC and CDKN2A
 BCL2 antibody  >344 publications with MYC and BCL2
 SP1 antibody  >264 publications with MYC and SP1
 CDK4 antibody  >243 publications with MYC and CDK4
 E2F1 antibody  >222 publications with MYC and E2F1
 BRCA1 antibody  >118 publications with MYC and BRCA1
 MXI1 antibody  >109 publications with MYC and MXI1
 MAPK3 antibody  >107 publications with MYC and MAPK3

Pathways associated with anti-MYC antibody

 Products by Pathway  Pathway Diagram
 Acute Myeloid Leukemia Pathway antibodies  Acute Myeloid Leukemia Pathway Diagram
 Acute Myeloid Leukemia Pathway antibodies  Acute Myeloid Leukemia Pathway Diagram
 Apoptosis Pathway antibodies  Apoptosis Pathway Diagram
 Aryl Hydrocarbon Receptor Pathway antibodies  Aryl Hydrocarbon Receptor Pathway Diagram
 Association Between Physico-Chemical Features And Toxicity Associated Pathways antibodies  Association Between Physico-Chemical Features And Toxicity Associated Pathways Diagram
 B Cell Receptor Signaling Pathway antibodies  B Cell Receptor Signaling Pathway Diagram
 Binding Of TCF/LEF:CTNNB1 To Target Gene Promoters Pathway antibodies  Binding Of TCF/LEF:CTNNB1 To Target Gene Promoters Pathway Diagram
 Bladder Cancer Pathway antibodies  Bladder Cancer Pathway Diagram
 Bladder Cancer Pathway antibodies  Bladder Cancer Pathway Diagram
 Bladder Cancer Pathway antibodies  Bladder Cancer Pathway Diagram

Diseases associated with anti-MYC antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >13725 publications with MYC and Neoplasms
 Cell Transformation, Neoplastic Antibodies  >2456 publications with MYC and Cell Transformation, Neoplastic
 Neoplasms, Experimental Antibodies  >2095 publications with MYC and Neoplasms, Experimental
 Neuroectodermal Tumors Antibodies  >2040 publications with MYC and Neuroectodermal Tumors
 Adenocarcinoma Antibodies  >1470 publications with MYC and Adenocarcinoma
 Neuroblastoma Antibodies  >1432 publications with MYC and Neuroblastoma
 Breast Neoplasms Antibodies  >1273 publications with MYC and Breast Neoplasms
 Liver Neoplasms Antibodies  >971 publications with MYC and Liver Neoplasms
 Liver Diseases Antibodies  >945 publications with MYC and Liver Diseases
 Burkitt Lymphoma Antibodies  >871 publications with MYC and Burkitt Lymphoma

Organs/Tissues associated with anti-MYC antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >3293 publications with MYC and Blood
 Liver Antibodies  >1781 publications with MYC and Liver
 Lung Antibodies  >1278 publications with MYC and Lung
 Bone Antibodies  >1212 publications with MYC and Bone
 Brain Antibodies  >1070 publications with MYC and Brain
 Muscle Antibodies  >1039 publications with MYC and Muscle
 Bone Marrow Antibodies  >861 publications with MYC and Bone Marrow
 Vascular Antibodies  >818 publications with MYC and Vascular
 Kidney Antibodies  >787 publications with MYC and Kidney
 Embryonic Tissue Antibodies  >631 publications with MYC and Embryonic Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000