Mouse Anti-GTF3A Monoclonal Antibody – Cat# MBS6167888

Detection limit for recombinant GST tagged GTF3A is approximately 0.3ng/ml as a capture antibody.

GTF3A Antibody – Mouse Monoclonal

Name: GTF3A Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6167888
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6167888

The product of this gene is a zinc finger protein with nine Cis[2]-His[2] zinc finger domains. It functions as an RNA polymerase III transcription factor to induce transcription of the 5S rRNA genes. The protein binds to a 50 bp internal promoter in the 5S… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

GTF3A, Monoclonal Antibody

Full Product Name

GTF3A (General Transcription Factor IIIA, AP2, TFIIIA) (APC)

Product Gene Name

anti-GTF3A antibody

Product Synonym Names

General Transcription Factor IIIA; AP2; TFIIIA

Clonality

Monoclonal

Isotype

IgG2b,k

Clone Number

3F7

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

Purity/Purification

Purified

Specificity

Recognizes GTF3A.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

600860

3D Structure

ModBase 3D Structure for Q92664

Immunogen

GTF3A (NP_002088, 185aa-274aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

NQQKQYICSFEDCKKTFKKHQQLKIHQCQNTNEPLFKCTQEGCGKHFASPSKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVRETHKEE

Conjugate

APC

Product Categories/Family for anti-GTF3A antibody

Antibodies; Transcription Factors

Applications Tested/Suitable for anti-GTF3A antibody

ELISA (EIA)

Application Notes for anti-GTF3A antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-GTF3A antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for GTF3A purchase

MBS6167888 is an antibody targeting GTF3A. Also known as GTF3A (General Transcription Factor IIIA, AP2, TFIIIA) (APC). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for GTF3A. It may not necessarily be applicable to this product.

NCBI GI #

166063995

NCBI GeneID

2971

NCBI Accession #

NP_002088

UniProt Primary Accession #

Q92664

UniProt Related Accession #

Q92664

GenBank Nucleotide #

NP_002088.2

NCBI Official Full Name

transcription factor IIIA

NCBI Official Synonym Full Names

general transcription factor IIIA

NCBI Official Symbol

GTF3A

NCBI Official Synonym Symbols

AP2; TFIIIA

UniProt Protein Name

Transcription factor IIIA

UniProt Gene Name

GTF3A

UniProt Synonym Gene Names

TFIIIA

UniProt Entry Name

TF3A_HUMAN

NCBI Protein Information

transcription factor IIIA

UniProt Comments for GTF3A

GTF3A: Interacts with the internal control region (ICR) of approximately 50 bases within the 5S RNA genes, is required for correct transcription of these genes by RNA polymerase III. Also binds the transcribed 5S RNA's. May initiate transcription of the 5S ribosomal RNA gene and maintain the stability of transcription of other genes. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein; Transcription initiation complex

Chromosomal Location of Human Ortholog: 13q12.3-q13.1

Cellular Component: nucleoplasm; nucleus

Molecular Function: DNA binding; RNA binding; metal ion binding

Biological Process: transcription from RNA polymerase III promoter; regulation of transcription, DNA-dependent; gene expression; rRNA transcription

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-GTF3A antibody

Products by Pathway	Pathway Diagram
Adipogenesis Pathway antibodies	Adipogenesis Pathway Diagram
Gene Expression Pathway antibodies	Gene Expression Pathway Diagram
IL4-mediated Signaling Events Pathway antibodies	IL4-mediated Signaling Events Pathway Diagram
RNA Polymerase I, RNA Polymerase III, And Mitochondrial Transcription Pathway antibodies	RNA Polymerase I, RNA Polymerase III, And Mitochondrial Transcription Pathway Diagram
RNA Polymerase III Abortive And Retractive Initiation Pathway antibodies	RNA Polymerase III Abortive And Retractive Initiation Pathway Diagram
RNA Polymerase III Transcription Pathway antibodies	RNA Polymerase III Transcription Pathway Diagram
RNA Polymerase III Transcription Initiation Pathway antibodies	RNA Polymerase III Transcription Initiation Pathway Diagram
RNA Polymerase III Transcription Initiation From Type 1 Promoter Pathway antibodies	RNA Polymerase III Transcription Initiation From Type 1 Promoter Pathway Diagram

Diseases associated with anti-GTF3A antibody

Disease Name	Pubmed Publications
Abnormalities, Multiple Antibodies	>1 publications with GTF3A and Abnormalities, Multiple
Neurobehavioral Manifestations Antibodies	>1 publications with GTF3A and Neurobehavioral Manifestations
Congenital Abnormalities Antibodies	>1 publications with GTF3A and Congenital Abnormalities

Organs/Tissues associated with anti-GTF3A antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>1 publications with GTF3A and Blood
Connective Tissue Antibodies	>1 publications with GTF3A and Connective Tissue