• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

RNF125 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6168356

This gene encodes a novel E3 ubiquitin ligase that contains an N-terminal RING finger domain. The encoded protein may function as a positive regulator in the T-cell receptor signaling pathway. [provided by RefSeq] More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
RNF125, Monoclonal Antibody
Full Product Name
RNF125 (RING Finger Protein 125, FLJ20456, MGC21737, TRAC1) (APC)
Product Gene Name
anti-RNF125 antibody
Product Synonym Names
Ring Finger Protein 125; FLJ20456; MGC21737; TRAC1
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D3
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified
Specificity
Recognizes RNF125.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
26kDa
OMIM
610432
3D Structure
ModBase 3D Structure for Q96EQ8
Immunogen
RNF125 (NP_060301, 143aa-231aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNT
Conjugate
APC

Product Categories/Family for anti-RNF125 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger
Applications Tested/Suitable for anti-RNF125 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-RNF125 antibody
Applications are based on unconjugated antibody.

Testing Data of anti-RNF125 antibody

Detection limit for recombinant GST tagged RNF125 is 0.1 ng/ml as a capture antibody.
Mouse Anti-RNF125 Monoclonal Antibody – Cat# MBS6168356

Immunofluorescence (IF) of anti-RNF125 antibody

Immunofluorescence of monoclonal antibody to RNF125 on HeLa cell. [antibody concentration 10 ug/ml]
Mouse Anti-RNF125 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6168356

Immunofluorescence (IF) of anti-RNF125 antibody

Immunofluorescence of monoclonal antibody to RNF125 on HeLa cell. [antibody concentration 10 ug/ml]
Mouse Anti-RNF125 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6168356

Other Notes

Small volumes of anti-RNF125 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for RNF125 purchase

MBS6168356 is an antibody targeting RNF125. Also known as RNF125 (RING Finger Protein 125, FLJ20456, MGC21737, TRAC1) (APC). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for RNF125. It may not necessarily be applicable to this product.

NCBI GI #
37595555
NCBI GeneID
54941
NCBI Accession #
NP_060301
UniProt Primary Accession #
Q96EQ8
UniProt Related Accession #
Q96EQ8
GenBank Nucleotide #
NM_017831
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF125
NCBI Official Synonym Full Names
ring finger protein 125
NCBI Official Symbol
RNF125
NCBI Official Synonym Symbols
TNORS; TRAC1; TRAC-1
UniProt Protein Name
E3 ubiquitin-protein ligase RNF125
UniProt Synonym Protein Names
RING finger protein 125; T-cell RING activation protein 1
Protein Family
E3 ubiquitin-protein ligase
UniProt Gene Name
RNF125
UniProt Synonym Gene Names
TRAC-1
UniProt Entry Name
RN125_HUMAN
NCBI Protein Information
E3 ubiquitin-protein ligase RNF125

NCBI Summary for RNF125

This gene encodes a novel E3 ubiquitin ligase that contains a RING finger domain in the N-terminus and three zinc-binding and one ubiquitin-interacting motif in the C-terminus. As a result of myristoylation, this protein associates with membranes and is primarily localized to intracellular membrane systems. The encoded protein may function as a positive regulator in the T-cell receptor signaling pathway. [provided by RefSeq, Mar 2012]
Show more

UniProt Comments for RNF125

RNF125: E3 ubiquitin-protein ligase that acts as a positive regulator of T-cell activation. E3 ligase proteins mediate ubiquitination and subsequent proteasomal degradation of target proteins.

Protein type: Ubiquitin conjugating system; Ubiquitin ligase; EC 6.3.2.19; EC 6.3.2.-; Ligase

Chromosomal Location of Human Ortholog: 18q12.1

Molecular Function: zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: protein ubiquitination; innate immune response; negative regulation of interferon type I production

Disease: Tenorio Syndrome
Show more

Research Articles on RNF125

1. this study shows that RNF125 activates Interleukin-36 receptor signaling and contributes to its turnover

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-RNF125 antibody

 Products by Pathway  Pathway Diagram
 Immune System Pathway antibodies  Immune System Pathway Diagram
 Innate Immune System Pathway antibodies  Innate Immune System Pathway Diagram
 Negative Regulators Of RIG-I/MDA5 Signaling Pathway antibodies  Negative Regulators Of RIG-I/MDA5 Signaling Pathway Diagram
 RIG-I-like Receptor Signaling Pathway antibodies  RIG-I-like Receptor Signaling Pathway Diagram
 RIG-I-like Receptor Signaling Pathway antibodies  RIG-I-like Receptor Signaling Pathway Diagram
 RIG-I/MDA5 Mediated Induction Of IFN-alpha/beta Pathways antibodies  RIG-I/MDA5 Mediated Induction Of IFN-alpha/beta Pathways Diagram

Diseases associated with anti-RNF125 antibody

 Disease Name  Pubmed Publications
 Hepatitis Antibodies  >3 publications with RNF125 and Hepatitis
 Liver Diseases Antibodies  >3 publications with RNF125 and Liver Diseases
 Neoplasms Antibodies  >2 publications with RNF125 and Neoplasms
 Inflammation Antibodies  >1 publications with RNF125 and Inflammation
 Liver Neoplasms Antibodies  >1 publications with RNF125 and Liver Neoplasms

Organs/Tissues associated with anti-RNF125 antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >3 publications with RNF125 and Liver
 Lung Antibodies  >1 publications with RNF125 and Lung
 Skin Antibodies  >1 publications with RNF125 and Skin
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000