• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PHGDH Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6169318

3-Phosphoglycerate dehydrogenase (PHGDH; EC 1.1.1.95) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PHGDH, Monoclonal Antibody
Full Product Name
PHGDH (Phosphoglycerate Dehydrogenase, 3-PGDH, 3PGDH, MGC3017, PDG, PGAD, PGD, PGDH, SERA) (APC)
Product Gene Name
anti-PHGDH antibody
Product Synonym Names
Phosphoglycerate Dehydrogenase; 3-PGDH; 3PGDH; MGC3017; PDG; PGAD; PGD; PGDH; SERA
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D5-1F11
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified
Specificity
Recognizes PHGDH.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
56,651 Da
Chromosome Location
Chromosome: 1; NC_000001.11 (119711796..119744226). Location: 1p12
OMIM
phenotype 606879
3D Structure
ModBase 3D Structure for O43175
Immunogen
PHGDH (AAH11262.1, 1aa-533aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF
Conjugate
APC

Product Categories/Family for anti-PHGDH antibody

Antibodies; Enzymes; Dehydrogenase
Applications Tested/Suitable for anti-PHGDH antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-PHGDH antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-PHGDH antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PHGDH purchase

MBS6169318 is an antibody targeting PHGDH. Also known as PHGDH (Phosphoglycerate Dehydrogenase, 3-PGDH, 3PGDH, MGC3017, PDG, PGAD, PGD, PGDH, SERA) (APC). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for PHGDH. It may not necessarily be applicable to this product.

NCBI GI #
15030035
NCBI GeneID
26227
NCBI Accession #
AAH11262.1
UniProt Primary Accession #
O43175
UniProt Secondary Accession #
Q5SZU3; Q9BQ01; B2RD08
UniProt Related Accession #
O43175
NCBI Official Full Name
Phosphoglycerate dehydrogenase
NCBI Official Synonym Full Names
phosphoglycerate dehydrogenase
NCBI Official Symbol
PHGDH
NCBI Official Synonym Symbols
PDG; PGD; PGAD; PGDH; SERA; 3PGDH; 3-PGDH; HEL-S-113
UniProt Protein Name
D-3-phosphoglycerate dehydrogenase
UniProt Gene Name
PHGDH
UniProt Synonym Gene Names
PGDH3; 3-PGDH
UniProt Entry Name
SERA_HUMAN
NCBI Protein Information
D-3-phosphoglycerate dehydrogenase; epididymis secretory protein Li 113

UniProt Comments for PHGDH

PHGDH: Defects in PHGDH are the cause of phosphoglycerate dehydrogenase deficiency (PHGDH deficiency). It is characterized by congenital microcephaly, psychomotor retardation, and seizures. Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.

Protein type: Oxidoreductase; Amino Acid Metabolism - glycine, serine and threonine; EC 1.1.1.95; Cell development/differentiation

Chromosomal Location of Human Ortholog: 1p12

Cellular Component: cytosol

Molecular Function: electron carrier activity; NAD binding; phosphoglycerate dehydrogenase activity

Biological Process: neural tube development; glial cell development; glycine metabolic process; gamma-aminobutyric acid metabolic process; glutamine metabolic process; L-serine biosynthetic process; spinal cord development; regulation of gene expression; amino acid biosynthetic process; brain development; taurine metabolic process; neurite development; threonine metabolic process

Disease: Phosphoglycerate Dehydrogenase Deficiency; Neu-laxova Syndrome 1
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PHGDH antibody

 Reference Product  PubMed Publications
 PSAT1 antibody  >5 publications with PHGDH and PSAT1
 PSPH antibody  >3 publications with PHGDH and PSPH
 ASNS antibody  >1 publications with PHGDH and ASNS

Pathways associated with anti-PHGDH antibody

 Products by Pathway  Pathway Diagram
 Amino Acid Synthesis And Interconversion (transamination) Pathway antibodies  Amino Acid Synthesis And Interconversion (transamination) Pathway Diagram
 Biosynthesis Of Amino Acids Pathway antibodies  Biosynthesis Of Amino Acids Pathway Diagram
 Biosynthesis Of Amino Acids Pathway antibodies  Biosynthesis Of Amino Acids Pathway Diagram
 Carbon Metabolism Pathway antibodies  Carbon Metabolism Pathway Diagram
 Carbon Metabolism Pathway antibodies  Carbon Metabolism Pathway Diagram
 Glycine, Serine And Threonine Metabolism Pathway antibodies  Glycine, Serine And Threonine Metabolism Pathway Diagram
 Glycine, Serine And Threonine Metabolism Pathway antibodies  Glycine, Serine And Threonine Metabolism Pathway Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 Metabolism Of Amino Acids And Derivatives Pathway antibodies  Metabolism Of Amino Acids And Derivatives Pathway Diagram
 Serine Biosynthesis Pathway antibodies  Serine Biosynthesis Pathway Diagram

Diseases associated with anti-PHGDH antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >15 publications with PHGDH and Neoplasms
 Phosphoglycerate Dehydrogenase Deficiency Antibodies  >10 publications with PHGDH and Phosphoglycerate Dehydrogenase Deficiency
 Breast Neoplasms Antibodies  >8 publications with PHGDH and Breast Neoplasms
 Melanoma Antibodies  >5 publications with PHGDH and Melanoma
 Nervous System Diseases Antibodies  >4 publications with PHGDH and Nervous System Diseases
 Cell Transformation, Neoplastic Antibodies  >4 publications with PHGDH and Cell Transformation, Neoplastic
 Liver Diseases Antibodies  >3 publications with PHGDH and Liver Diseases
 Adenocarcinoma Antibodies  >3 publications with PHGDH and Adenocarcinoma
 Seizures Antibodies  >3 publications with PHGDH and Seizures
 Neoplasms, Experimental Antibodies  >2 publications with PHGDH and Neoplasms, Experimental

Organs/Tissues associated with anti-PHGDH antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >14 publications with PHGDH and Brain
 Liver Antibodies  >7 publications with PHGDH and Liver
 Blood Antibodies  >3 publications with PHGDH and Blood
 Lung Antibodies  >3 publications with PHGDH and Lung
 Embryonic Tissue Antibodies  >2 publications with PHGDH and Embryonic Tissue
 Nerve Antibodies  >2 publications with PHGDH and Nerve
 Bone Antibodies  >1 publications with PHGDH and Bone
 Muscle Antibodies  >1 publications with PHGDH and Muscle
 Uterus Antibodies  >1 publications with PHGDH and Uterus
 Skin Antibodies  >1 publications with PHGDH and Skin
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000