Mouse Anti-CILP Monoclonal Antibody – Cat# MBS6169393

Detection limit for recombinant GST tagged CILP is 0.3 ng/ml as a capture antibody.

CILP Antibody – Mouse Monoclonal

Name: CILP Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6169393
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6169393

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

CILP, Monoclonal Antibody

Full Product Name

CILP (Cartilage Intermediate layer Protein, Nucleotide pyrophosphohydrolase, CILP-1, HsT18872) (APC)

Product Gene Name

anti-CILP antibody

Product Synonym Names

Cartilage Intermediate layer Protein; Nucleotide pyrophosphohydrolase; CILP-1; HsT18872

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

2D10

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

Purity/Purification

Purified

Specificity

Recognizes CILP.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

52kDa

OMIM

603489

3D Structure

ModBase 3D Structure for O75339

Immunogen

CILP (NP_003604, 129aa-226aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

NCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFML

Conjugate

APC

Product Categories/Family for anti-CILP antibody

Antibodies; Extracellular Matrix Proteins

Applications Tested/Suitable for anti-CILP antibody

ELISA (EIA)

Application Notes for anti-CILP antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-CILP antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CILP purchase

MBS6169393 is an antibody targeting CILP. Also known as CILP (Cartilage Intermediate layer Protein, Nucleotide pyrophosphohydrolase, CILP-1, HsT18872) (APC). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CILP. It may not necessarily be applicable to this product.

NCBI GI #

1519313775

NCBI GeneID

8483

NCBI Accession #

NP_003604

UniProt Primary Accession #

O75339

UniProt Related Accession #

O75339

GenBank Nucleotide #

NM_003613

NCBI Official Full Name

cartilage intermediate layer protein 1 preproprotein

NCBI Official Synonym Full Names

cartilage intermediate layer protein

NCBI Official Symbol

CILP

NCBI Official Synonym Symbols

CILP-1; HsT18872

UniProt Protein Name

Cartilage intermediate layer protein 1

UniProt Synonym Protein Names

Cartilage intermediate-layer protein

Protein Family

Cartilage intermediate layer protein

UniProt Gene Name

CILP

UniProt Entry Name

CILP1_HUMAN

NCBI Protein Information

cartilage intermediate layer protein 1

NCBI Summary for CILP

Major alterations in the composition of the cartilage extracellular matrix occur in joint disease, such as osteoarthrosis. This gene encodes the cartilage intermediate layer protein (CILP), which increases in early osteoarthrosis cartilage. The encoded protein was thought to encode a protein precursor for two different proteins; an N-terminal CILP and a C-terminal homolog of NTPPHase, however, later studies identified no nucleotide pyrophosphatase phosphodiesterase (NPP) activity. The full-length and the N-terminal domain of this protein was shown to function as an IGF-1 antagonist. An allelic variant of this gene has been associated with lumbar disc disease. [provided by RefSeq, Sep 2010]

Research Articles on CILP

1. CILP gene polymorphism (rs2073711) is associated with a lower risk of lumbar disc degeneration.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.