• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

IRF2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6171716

IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
IRF2, Monoclonal Antibody
Full Product Name
IRF2 (Interferon Regulatory Factor 2, DKFZp686F0244, IRF-2) (Biotin)
Product Gene Name
anti-IRF2 antibody
Product Synonym Names
Interferon Regulatory Factor 2; DKFZp686F0244; IRF-2
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
7C2
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified
Specificity
Recognizes IRF2.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
15 kDa (133 aa), confirmed by MALDI-TOF.
OMIM
147576
3D Structure
ModBase 3D Structure for P14316
Immunogen
IRF2 (NP_002190, 216aa-315aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSS
Conjugate
Biotin

Product Categories/Family for anti-IRF2 antibody

Antibodies; Interferon
Applications Tested/Suitable for anti-IRF2 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-IRF2 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-IRF2 antibody

IRF2 monoclonal antibody (M04), clone 7C2 Western Blot analysis of IRF2 expression in Hela S3 NE.
Mouse Anti-IRF2 Monoclonal Antibody – Cat# MBS6171716

Immunofluorescence (IF) of anti-IRF2 antibody

Immunofluorescence of monoclonal antibody to IRF2 on HeLa cell. [antibody concentration 10 ug/ml]
Mouse Anti-IRF2 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6171716

Immunofluorescence (IF) of anti-IRF2 antibody

Immunofluorescence of monoclonal antibody to IRF2 on HeLa cell. [antibody concentration 10 ug/ml]
Mouse Anti-IRF2 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6171716

Testing Data of anti-IRF2 antibody

Detection limit for recombinant GST tagged IRF2 is approximately 0.03ng/ml as a capture antibody.
Mouse Anti-IRF2 Monoclonal Antibody, Testing Data – Cat# MBS6171716

Other Notes

Small volumes of anti-IRF2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for IRF2 purchase

MBS6171716 is an antibody targeting IRF2. Also known as IRF2 (Interferon Regulatory Factor 2, DKFZp686F0244, IRF-2) (Biotin). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for IRF2. It may not necessarily be applicable to this product.

NCBI GI #
153082752
NCBI GeneID
3660
NCBI Accession #
NP_002190
UniProt Primary Accession #
P14316
UniProt Secondary Accession #
Q6IAS7; Q96B99; D6RCK5; H0Y8S3
UniProt Related Accession #
P14316
GenBank Nucleotide #
NM_002199.3
NCBI Official Full Name
interferon regulatory factor 2
NCBI Official Synonym Full Names
interferon regulatory factor 2
NCBI Official Symbol
IRF2
NCBI Official Synonym Symbols
IRF-2
UniProt Protein Name
Interferon regulatory factor 2
Protein Family
Interferon regulatory factor
UniProt Gene Name
IRF2
UniProt Synonym Gene Names
IRF-2
UniProt Entry Name
IRF2_HUMAN
NCBI Protein Information
interferon regulatory factor 2

UniProt Comments for IRF2

IRF2: Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes. Also acts as an activator for several genes including H4 and IL7. Constitutively binds to the ISRE promoter to activate IL7. Involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth. Antagonizes IRF1 transcriptional activation. Interacts with BRD7, IRF2BP1 and IRF2BP2. Interacts with CREBBP in growing cells; the interaction acetylates IRF2 and regulates IRF2-dependent H4 promoter activity. By viruses and IFN. Expressed throughout the epithelium of the colon. Also expressed in lamina propria. Belongs to the IRF family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 4q34.1-q35.1

Cellular Component: nucleoplasm; focal adhesion; cytoplasm; cytosol

Molecular Function: protein binding; DNA binding; transcription factor activity

Biological Process: cell proliferation; regulation of transcription, DNA-dependent; transcription, DNA-dependent; cytokine and chemokine mediated signaling pathway; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; blood coagulation
Show more

Research Articles on IRF2

1. The effects of IRF2 suppresses non-small cell lung cancer by promoting cell apoptosis, inhibiting cell proliferation and migration ability.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-IRF2 antibody

 Reference Product  PubMed Publications
 STAT1 antibody  >30 publications with IRF2 and STAT1
 IRF8 antibody  >7 publications with IRF2 and IRF8
 EP300 antibody  >3 publications with IRF2 and EP300
 RELA antibody  >1 publications with IRF2 and RELA
 NFKB1 antibody  >1 publications with IRF2 and NFKB1

Pathways associated with anti-IRF2 antibody

 Products by Pathway  Pathway Diagram
 Apoptosis Pathway antibodies  Apoptosis Pathway Diagram
 Cytokine Signaling In Immune System Pathway antibodies  Cytokine Signaling In Immune System Pathway Diagram
 Factors Involved In Megakaryocyte Development And Platelet Production Pathway antibodies  Factors Involved In Megakaryocyte Development And Platelet Production Pathway Diagram
 Hemostasis Pathway antibodies  Hemostasis Pathway Diagram
 Immune System Pathway antibodies  Immune System Pathway Diagram
 Innate Immune System Pathway antibodies  Innate Immune System Pathway Diagram
 Interferon Signaling Pathway antibodies  Interferon Signaling Pathway Diagram
 Interferon Alpha/beta Signaling Pathway antibodies  Interferon Alpha/beta Signaling Pathway Diagram
 Interferon Gamma Signaling Pathway antibodies  Interferon Gamma Signaling Pathway Diagram
 RIG-I/MDA5 Mediated Induction Of IFN-alpha/beta Pathways antibodies  RIG-I/MDA5 Mediated Induction Of IFN-alpha/beta Pathways Diagram

Diseases associated with anti-IRF2 antibody

 Disease Name  Pubmed Publications
 Necrosis Antibodies  >13 publications with IRF2 and Necrosis
 Cell Transformation, Neoplastic Antibodies  >10 publications with IRF2 and Cell Transformation, Neoplastic
 Death Antibodies  >10 publications with IRF2 and Death
 Liver Diseases Antibodies  >10 publications with IRF2 and Liver Diseases
 Inflammation Antibodies  >10 publications with IRF2 and Inflammation
 Hepatitis Antibodies  >8 publications with IRF2 and Hepatitis
 Nervous System Diseases Antibodies  >8 publications with IRF2 and Nervous System Diseases
 Breast Neoplasms Antibodies  >5 publications with IRF2 and Breast Neoplasms
 Liver Neoplasms Antibodies  >4 publications with IRF2 and Liver Neoplasms
 Brain Diseases Antibodies  >4 publications with IRF2 and Brain Diseases

Organs/Tissues associated with anti-IRF2 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >48 publications with IRF2 and Blood
 Bone Antibodies  >20 publications with IRF2 and Bone
 Bone Marrow Antibodies  >19 publications with IRF2 and Bone Marrow
 Liver Antibodies  >15 publications with IRF2 and Liver
 Skin Antibodies  >12 publications with IRF2 and Skin
 Lung Antibodies  >11 publications with IRF2 and Lung
 Brain Antibodies  >8 publications with IRF2 and Brain
 Uterus Antibodies  >7 publications with IRF2 and Uterus
 Spleen Antibodies  >7 publications with IRF2 and Spleen
 Heart Antibodies  >4 publications with IRF2 and Heart
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000