• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ACHE Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6171875

Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes, where it constitutes the Yt blood group… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ACHE, Monoclonal Antibody
Full Product Name
ACHE (Acetylcholinesterase (Yt Blood Group), ARACHE, N-ACHE, YT) (Biotin)
Product Gene Name
anti-ACHE antibody
Product Synonym Names
Acetylcholinesterase (Yt Blood Group); ARACHE; N-ACHE; YT
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C3
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified
Specificity
Recognizes ACHE.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
58,352 Da
OMIM
100740
3D Structure
ModBase 3D Structure for P22303
Immunogen
ACHE (NP_000656, 515aa-614aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQDRCSDL
Conjugate
Biotin

Product Categories/Family for anti-ACHE antibody

Antibodies; Enzymes; Acetylcholinesterase
Applications Tested/Suitable for anti-ACHE antibody
ELISA (EIA)
Application Notes for anti-ACHE antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-ACHE antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ACHE purchase

MBS6171875 is an antibody targeting ACHE. Also known as ACHE (Acetylcholinesterase (Yt Blood Group), ARACHE, N-ACHE, YT) (Biotin). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for ACHE. It may not necessarily be applicable to this product.

NCBI GI #
4557239
NCBI GeneID
43
NCBI Accession #
NP_000656
UniProt Primary Accession #
P22303
UniProt Secondary Accession #
Q16169; Q29S23; Q2M324; Q504V3; Q53F46; Q86TM9; Q86YX9; Q9BXP7; A4D2E2; B7ZKZ0; D6W5X7
UniProt Related Accession #
P22303
GenBank Nucleotide #
NM_000665
NCBI Official Full Name
acetylcholinesterase isoform E4-E6
NCBI Official Synonym Full Names
acetylcholinesterase (Yt blood group)
NCBI Official Symbol
ACHE
NCBI Official Synonym Symbols
YT; ACEE; ARACHE; N-ACHE
UniProt Protein Name
Acetylcholinesterase
Protein Family
Achelase
UniProt Gene Name
ACHE
UniProt Synonym Gene Names
AChE
UniProt Entry Name
ACES_HUMAN
NCBI Protein Information
acetylcholinesterase; Yt blood group; apoptosis-related acetylcholinesterase

UniProt Comments for ACHE

ACHE: Terminates signal transduction at the neuromuscular junction by rapid hydrolysis of the acetylcholine released into the synaptic cleft. Role in neuronal apoptosis. Belongs to the type-B carboxylesterase/lipase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Membrane protein, GPI anchor; Lipid Metabolism - glycerophospholipid; EC 3.1.1.7

Chromosomal Location of Human Ortholog: 7q22

Cellular Component: Golgi apparatus; extracellular space; cell surface; membrane; perinuclear region of cytoplasm; extracellular region; plasma membrane; synapse; basal lamina; neuromuscular junction; nucleus; cell junction

Molecular Function: collagen binding; serine hydrolase activity; protein binding; protein homodimerization activity; protein self-association; cholinesterase activity; hydrolase activity; beta-amyloid binding; laminin binding; acetylcholinesterase activity; acetylcholine binding

Biological Process: negative regulation of synaptic transmission, cholinergic; nervous system development; muscle development; acetylcholine catabolic process in synaptic cleft; acetylcholine catabolic process; glycerophospholipid biosynthetic process; osteoblast development; synaptic transmission; cell proliferation; synaptogenesis; positive regulation of protein secretion; amyloid precursor protein metabolic process; retina development in camera-type eye; phospholipid metabolic process; neurotransmitter receptor biosynthetic process; receptor internalization; response to wounding; phosphatidylcholine biosynthetic process; regulation of receptor recycling; DNA replication; cell adhesion; protein tetramerization; neurotransmitter biosynthetic process

Disease: Yt Blood Group Antigen
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ACHE antibody

 Reference Product  PubMed Publications
 APP antibody  >148 publications with ACHE and APP
 COLQ antibody  >79 publications with ACHE and COLQ
 PRIMA1 antibody  >15 publications with ACHE and PRIMA1
 LAMB1 antibody  >1 publications with ACHE and LAMB1

Pathways associated with anti-ACHE antibody

 Products by Pathway  Pathway Diagram
 ATF-2 Transcription Factor Network Pathway antibodies  ATF-2 Transcription Factor Network Pathway Diagram
 Acetylcholine Synthesis Pathway antibodies  Acetylcholine Synthesis Pathway Diagram
 Biogenic Amine Synthesis Pathway antibodies  Biogenic Amine Synthesis Pathway Diagram
 Cholinergic Synapse Pathway antibodies  Cholinergic Synapse Pathway Diagram
 Glycerophospholipid Biosynthesis Pathway antibodies  Glycerophospholipid Biosynthesis Pathway Diagram
 Glycerophospholipid Metabolism Pathway antibodies  Glycerophospholipid Metabolism Pathway Diagram
 Glycerophospholipid Metabolism Pathway antibodies  Glycerophospholipid Metabolism Pathway Diagram
 Integrated Pancreatic Cancer Pathway antibodies  Integrated Pancreatic Cancer Pathway Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 Metabolism Of Lipids And Lipoproteins Pathway antibodies  Metabolism Of Lipids And Lipoproteins Pathway Diagram

Diseases associated with anti-ACHE antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >217075 publications with ACHE and Nervous System Diseases
 Neoplasms Antibodies  >61466 publications with ACHE and Neoplasms
 Brain Diseases Antibodies  >27509 publications with ACHE and Brain Diseases
 Inflammation Antibodies  >20680 publications with ACHE and Inflammation
 Death Antibodies  >15980 publications with ACHE and Death
 Fever Antibodies  >15512 publications with ACHE and Fever
 Necrosis Antibodies  >11287 publications with ACHE and Necrosis
 Hypertension Antibodies  >10562 publications with ACHE and Hypertension
 Kidney Diseases Antibodies  >10040 publications with ACHE and Kidney Diseases
 Edema Antibodies  >9639 publications with ACHE and Edema

Organs/Tissues associated with anti-ACHE antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >71957 publications with ACHE and Blood
 Nerve Antibodies  >41926 publications with ACHE and Nerve
 Heart Antibodies  >37873 publications with ACHE and Heart
 Muscle Antibodies  >37775 publications with ACHE and Muscle
 Brain Antibodies  >32954 publications with ACHE and Brain
 Liver Antibodies  >12463 publications with ACHE and Liver
 Kidney Antibodies  >11816 publications with ACHE and Kidney
 Intestine Antibodies  >10980 publications with ACHE and Intestine
 Lung Antibodies  >10465 publications with ACHE and Lung
 Mouth Antibodies  >9180 publications with ACHE and Mouth
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000