Mouse Anti-ID1 Monoclonal Antibody – Cat# MBS6176641

Detection limit for recombinant GST tagged ID1 is approximately 1ng/ml as a capture antibody.

ID1 Antibody – Mouse Monoclonal

Name: ID1 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6176641
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6176641

The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

ID1, Monoclonal Antibody

Full Product Name

ID1 (Inhibitor of DNA Binding 1, Dominant Negative Helix-loop-Helix Protein, ID, bHLHb24) (FITC)

Product Gene Name

anti-ID1 antibody

Product Synonym Names

Inhibitor of DNA Binding 1; Dominant Negative Helix-loop-Helix Protein; ID; bHLHb24

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

3F8

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Purity/Purification

Purified

Specificity

Recognizes ID1.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

18.5 kDa (178aa) confirmed by MALDI-TOF

OMIM

600349

3D Structure

ModBase 3D Structure for P41134

Immunogen

ID1 (NP_002156, 47aa-155aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

GGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR*

Conjugate

FITC

Product Categories/Family for anti-ID1 antibody

Antibodies; Binding Proteins

Applications Tested/Suitable for anti-ID1 antibody

Western Blot (WB)

Application Notes for anti-ID1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-ID1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ID1 purchase

MBS6176641 is an antibody targeting ID1. Also known as ID1 (Inhibitor of DNA Binding 1, Dominant Negative Helix-loop-Helix Protein, ID, bHLHb24) (FITC). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for ID1. It may not necessarily be applicable to this product.

NCBI GI #

31317299

NCBI GeneID

3397

NCBI Accession #

NP_002156

UniProt Primary Accession #

P41134

UniProt Secondary Accession #

O00651; O00652; Q16371; Q16377; Q5TE66; Q5TE67; Q969Z7; Q9H0Z5; Q9H109; A8K537; E1P5L4

UniProt Related Accession #

P41134

GenBank Nucleotide #

NM_002165.3

NCBI Official Full Name

DNA-binding protein inhibitor ID-1 isoform a

NCBI Official Synonym Full Names

inhibitor of DNA binding 1, HLH protein

NCBI Official Symbol

ID1

NCBI Official Synonym Symbols

ID; bHLHb24

UniProt Protein Name

DNA-binding protein inhibitor ID-1

UniProt Synonym Protein Names

Class B basic helix-loop-helix protein 24; bHLHb24; Inhibitor of DNA binding 1; Inhibitor of differentiation 1

Protein Family

DNA-binding protein inhibitor

UniProt Gene Name

ID1

UniProt Synonym Gene Names

BHLHB24; ID; bHLHb24

UniProt Entry Name

ID1_HUMAN

NCBI Protein Information

DNA-binding protein inhibitor ID-1

UniProt Comments for ID1

ID1: ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; DNA-binding

Chromosomal Location of Human Ortholog: 20q11

Cellular Component: nucleoplasm; Golgi apparatus; nucleus

Molecular Function: protein dimerization activity; protein binding; transcription factor activity

Biological Process: circadian rhythm; collagen metabolic process; blood vessel endothelial cell migration; transcription, DNA-dependent; protein destabilization; heart development; negative regulation of transcription factor activity; negative regulation of transcription from RNA polymerase II promoter; regulation of angiogenesis; negative regulation of DNA binding; BMP signaling pathway; response to antibiotic; regulation of MAPKKK cascade; transforming growth factor beta receptor signaling pathway; blood vessel morphogenesis; negative regulation of osteoblast differentiation; endothelial cell morphogenesis; angiogenesis; negative regulation of transcription, DNA-dependent; negative regulation of apoptosis

Research Articles on ID1

1. a loss of CULLIN3 represents a common signaling node for controlling the activity of intracellular WNT and SHH signaling pathways mediated by ID1

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-ID1 antibody

Products by Pathway	Pathway Diagram
ALK1 Signaling Events Pathway antibodies	ALK1 Signaling Events Pathway Diagram
Cellular Senescence Pathway antibodies	Cellular Senescence Pathway Diagram
Cellular Responses To Stress Pathway antibodies	Cellular Responses To Stress Pathway Diagram
Hfe Effect On Hepcidin Production Pathway antibodies	Hfe Effect On Hepcidin Production Pathway Diagram
Hippo Signaling Pathway antibodies	Hippo Signaling Pathway Diagram
Hippo Signaling Pathway antibodies	Hippo Signaling Pathway Diagram
ID Signaling Pathway antibodies	ID Signaling Pathway Diagram
Neural Crest Differentiation Pathway antibodies	Neural Crest Differentiation Pathway Diagram
Notch-mediated HES/HEY Network Pathway antibodies	Notch-mediated HES/HEY Network Pathway Diagram
Oncogene Induced Senescence Pathway antibodies	Oncogene Induced Senescence Pathway Diagram

Diseases associated with anti-ID1 antibody

Disease Name	Pubmed Publications
Carcinoma Antibodies	>132 publications with ID1 and Carcinoma
Breast Neoplasms Antibodies	>57 publications with ID1 and Breast Neoplasms
Neoplasm Metastasis Antibodies	>53 publications with ID1 and Neoplasm Metastasis
Adenocarcinoma Antibodies	>51 publications with ID1 and Adenocarcinoma
Cell Transformation, Neoplastic Antibodies	>39 publications with ID1 and Cell Transformation, Neoplastic
Neoplasms, Experimental Antibodies	>36 publications with ID1 and Neoplasms, Experimental
Lung Neoplasms Antibodies	>36 publications with ID1 and Lung Neoplasms
Brain Diseases Antibodies	>24 publications with ID1 and Brain Diseases
Hypertension Antibodies	>24 publications with ID1 and Hypertension
Cardiovascular Diseases Antibodies	>24 publications with ID1 and Cardiovascular Diseases

Organs/Tissues associated with anti-ID1 antibody

Organ/Tissue Name	Pubmed Publications
Bone Antibodies	>253 publications with ID1 and Bone
Blood Antibodies	>163 publications with ID1 and Blood
Vascular Antibodies	>118 publications with ID1 and Vascular
Muscle Antibodies	>102 publications with ID1 and Muscle
Lung Antibodies	>80 publications with ID1 and Lung
Brain Antibodies	>79 publications with ID1 and Brain
Liver Antibodies	>69 publications with ID1 and Liver
Prostate Antibodies	>63 publications with ID1 and Prostate
Embryonic Tissue Antibodies	>60 publications with ID1 and Embryonic Tissue
Heart Antibodies	>37 publications with ID1 and Heart