• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

AMID Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6177530

The protein encoded by this gene has significant homology to NADH oxidoreductases and the apoptosis-inducing factor PDCD8/AIF. Overexpression of this gene has been shown to induce apoptosis. The expression of this gene is found to be induced by tumor… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
AMID, Monoclonal Antibody
Full Product Name
AMID (Apoptosis-inducing Factor, mitochondrion-Associated, 2, AMID, PRG3, RP11-367H5.2) (FITC)
Product Gene Name
anti-AMID antibody
Product Synonym Names
Apoptosis-inducing Factor; mitochondrion-Associated; 2; AMID; PRG3; RP11-367H5.2
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A11
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified
Specificity
Recognizes AMID.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
40kDa
OMIM
605159
3D Structure
ModBase 3D Structure for Q9BRQ8
Immunogen
AMID (NP_116186, 188aa-287aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCA
Conjugate
FITC

Product Categories/Family for anti-AMID antibody

Antibodies; Apoptosis
Applications Tested/Suitable for anti-AMID antibody
Immunoprecipitation (IP)
Application Notes for anti-AMID antibody
Applications are based on unconjugated antibody.

Testing Data of anti-AMID antibody

Detection limit for recombinant GST tagged AIFM2 is 0.1 ng/ml as a capture antibody.
Mouse Anti-AMID Monoclonal Antibody – Cat# MBS6177530

Immunoprecipitation (IP) of anti-AMID antibody

Immunoprecipitation of AIFM2 transfected lysate using anti-AIFM2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with AIFM2 MaxPab rabbit polyclonal antibody.
Mouse Anti-AMID Monoclonal Antibody, Immunoprecipitation (IP) – Cat# MBS6177530

Other Notes

Small volumes of anti-AMID antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for AMID purchase

MBS6177530 is an antibody targeting AMID. Also known as AMID (Apoptosis-inducing Factor, mitochondrion-Associated, 2, AMID, PRG3, RP11-367H5.2) (FITC). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for AMID. It may not necessarily be applicable to this product.

NCBI GI #
14318424
NCBI GeneID
84883
NCBI Accession #
NP_116186
UniProt Primary Accession #
Q9BRQ8
UniProt Related Accession #
Q9BRQ8
GenBank Nucleotide #
NM_032797
NCBI Official Full Name
apoptosis-inducing factor 2
NCBI Official Synonym Full Names
apoptosis inducing factor mitochondria associated 2
NCBI Official Symbol
AIFM2
NCBI Official Synonym Symbols
AMID; PRG3
UniProt Protein Name
Apoptosis-inducing factor 2
UniProt Synonym Protein Names
Apoptosis-inducing factor homologous mitochondrion-associated inducer of death; Apoptosis-inducing factor-like mitochondrion-associated inducer of death; p53-responsive gene 3 protein
Protein Family
N-acetylmuramoyl-L-alanine amidase
UniProt Gene Name
AIFM2
UniProt Synonym Gene Names
AMID; PRG3
UniProt Entry Name
AIFM2_HUMAN
NCBI Protein Information
apoptosis-inducing factor 2

NCBI Summary for AMID

This gene encodes a flavoprotein oxidoreductase that binds single stranded DNA and is thought to contribute to apoptosis in the presence of bacterial and viral DNA. The expression of this gene is also found to be induced by tumor suppressor protein p53 in colon cancer cells. [provided by RefSeq, Nov 2010]
Show more

UniProt Comments for AMID

AIFM2: Oxidoreductase, which may play a role in mediating a p53/TP53-dependent apoptosis response. Probable oxidoreductase that acts as a caspase-independent mitochondrial effector of apoptotic cell death. Binds to DNA in a sequence-independent manner. May contribute to genotoxin-induced growth arrest. Belongs to the FAD-dependent oxidoreductase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Oxidoreductase; Mitochondrial; Apoptosis; Membrane protein, integral; EC 1.-.-.-

Chromosomal Location of Human Ortholog: 10q22.1

Cellular Component: extracellular space; mitochondrial outer membrane; mitochondrion; cytoplasm; integral to membrane; lipid particle; cytosol

Molecular Function: FAD binding; NADH dehydrogenase (ubiquinone) activity; DNA binding; electron-transferring-flavoprotein dehydrogenase activity

Biological Process: apoptotic mitochondrial changes; positive regulation of apoptosis
Show more

Research Articles on AMID

1. Low AIFM2 expression is associated with T-cell lymphoblastic lymphoma.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-AMID antibody

 Reference Product  PubMed Publications
 TP53 antibody  >1 publications with AMID and TP53

Pathways associated with anti-AMID antibody

 Products by Pathway  Pathway Diagram
 Direct P53 Effectors Pathway antibodies  Direct P53 Effectors Pathway Diagram

Diseases associated with anti-AMID antibody

 Disease Name  Pubmed Publications
 Adenoma Antibodies  >1 publications with AMID and Adenoma
 Breast Neoplasms Antibodies  >1 publications with AMID and Breast Neoplasms
 Neoplasms, Experimental Antibodies  >1 publications with AMID and Neoplasms, Experimental
 Kidney Diseases Antibodies  >1 publications with AMID and Kidney Diseases

Organs/Tissues associated with anti-AMID antibody

 Organ/Tissue Name  Pubmed Publications
 Embryonic Tissue Antibodies  >1 publications with AMID and Embryonic Tissue
 Brain Antibodies  >1 publications with AMID and Brain
 Prostate Antibodies  >1 publications with AMID and Prostate
 Kidney Antibodies  >1 publications with AMID and Kidney
 Lung Antibodies  >1 publications with AMID and Lung
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000