Mouse Anti-EMID2 Monoclonal Antibody – Cat# MBS6179118

Detection limit for recombinant GST tagged EMID2 is 0.1 ng/ml as a capture antibody.

EMID2 Antibody – Mouse Monoclonal

Name: EMID2 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6179118
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6179118

MBS6179118 is an antibody targeting EMID2. Also known as EMID2 (EMI Domain Containing 2, COL26A1, EMI6, EMU2, MGC129848, hEmu2) (FITC). Host: Mouse. Mouse monoclonal antibody raised against a partial recombinant EMID2. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

EMID2, Monoclonal Antibody

Full Product Name

EMID2 (EMI Domain Containing 2, COL26A1, EMI6, EMU2, MGC129848, hEmu2) (FITC)

Product Gene Name

anti-EMID2 antibody

Product Synonym Names

EMI Domain Containing 2; COL26A1; EMI6; EMU2; MGC129848; hEmu2

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

2D10

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Purity/Purification

Purified

Specificity

Recognizes EMID2.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

45kDa

OMIM

608927

3D Structure

ModBase 3D Structure for Q96A83

Immunogen

EMID2 (NP_597714, 380aa-440aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

ILEHMIGIHDPLASPEGGSGQDAALRANLKMKRGGAQPDGVLAALLGPDPGQKSVDQASSR

Conjugate

FITC

Product Categories/Family for anti-EMID2 antibody

Antibodies; Collagen

Applications Tested/Suitable for anti-EMID2 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-EMID2 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-EMID2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for EMID2. It may not necessarily be applicable to this product.

NCBI GI #

118498339

NCBI GeneID

136227

NCBI Accession #

NP_597714

UniProt Primary Accession #

Q96A83

UniProt Related Accession #

Q96A83

GenBank Nucleotide #

NM_133457

NCBI Official Full Name

collagen alpha-1(XXVI) chain isoform 2

NCBI Official Synonym Full Names

collagen type XXVI alpha 1 chain

NCBI Official Symbol

COL26A1

NCBI Official Synonym Symbols

EMI6; EMU2; SH2B; EMID2

UniProt Protein Name

Collagen alpha-1(XXVI) chain

UniProt Synonym Protein Names

Alpha-1 type XXVI collagen; EMI domain-containing protein 2; Emilin and multimerin domain-containing protein 2; Emu2

UniProt Gene Name

COL26A1

UniProt Synonym Gene Names

EMID2; EMU2; Emu2

UniProt Entry Name

COQA1_HUMAN

NCBI Protein Information

collagen alpha-1(XXVI) chain

NCBI Summary for EMID2

This gene encodes a protein containing an emilin domain and two collagen stretches. This gene may be associated with aspirin-intolerant asthma. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]

UniProt Comments for EMID2

EMID2: 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: extracellular matrix; Golgi apparatus; proteinaceous extracellular matrix; collagen; endoplasmic reticulum lumen; plasma membrane; extracellular region

Biological Process: extracellular matrix disassembly; collagen catabolic process; extracellular matrix organization and biogenesis

Research Articles on EMID2

1. 13 EMID2 variants were significantly associated with the presence of nasal polyps in the overall asthma group.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.