Mouse Anti-ARL13B Monoclonal Antibody – Cat# MBS6179129

Detection limit for recombinant GST tagged ARL13B is 0.03 ng/ml as a capture antibody.

ARL13B Antibody – Mouse Monoclonal

Name: ARL13B Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6179129
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6179129

MBS6179129 is an antibody targeting ARL13B. Also known as ARL13B (ADP-Ribosylation Factor-like 13B, ARL2L1, DKFZp686E2075, DKFZp686L2472, DKFZp686M2074, DKFZp761H079, JBTS8, MGC120611, MGC120612) (FITC). Host: Mouse. Mouse monoclonal antibody raised against a… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

ARL13B, Monoclonal Antibody

Full Product Name

ARL13B (ADP-Ribosylation Factor-like 13B, ARL2L1, DKFZp686E2075, DKFZp686L2472, DKFZp686M2074, DKFZp761H079, JBTS8, MGC120611, MGC120612) (FITC)

Product Gene Name

anti-ARL13B antibody

Product Synonym Names

ADP-Ribosylation Factor-like 13B; ARL2L1; DKFZp686E2075; DKFZp686L2472; DKFZp686M2074; DKFZp761H079; JBTS8; MGC120611; MGC120612

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

6F11

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Purity/Purification

Purified

Specificity

Recognizes ARL13B.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

OMIM

608922

3D Structure

ModBase 3D Structure for Q3SXY8

Immunogen

ARL13B (NP_878899.1, 329aa-428aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

KNEDETDRPSLESANGKKKTKKLRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPNSDAHDVIS

Conjugate

FITC

Product Categories/Family for anti-ARL13B antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

Applications Tested/Suitable for anti-ARL13B antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-ARL13B antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-ARL13B antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for ARL13B. It may not necessarily be applicable to this product.

NCBI GI #

33598956

NCBI GeneID

200894

NCBI Accession #

NP_878899.1

UniProt Primary Accession #

Q3SXY8

UniProt Related Accession #

Q3SXY8

GenBank Nucleotide #

NP_878899.1

NCBI Official Full Name

ADP-ribosylation factor-like protein 13B isoform 1

NCBI Official Synonym Full Names

ADP ribosylation factor like GTPase 13B

NCBI Official Symbol

ARL13B

NCBI Official Synonym Symbols

JBTS8; ARL2L1

UniProt Protein Name

ADP-ribosylation factor-like protein 13B

UniProt Synonym Protein Names

ADP-ribosylation factor-like protein 2-like 1; ARL2-like protein 1

UniProt Gene Name

ARL13B

UniProt Synonym Gene Names

ARL2L1; ARL2-like protein 1

UniProt Entry Name

AR13B_HUMAN

NCBI Protein Information

ADP-ribosylation factor-like protein 13B

NCBI Summary for ARL13B

This gene encodes a member of the ADP-ribosylation factor-like family. The encoded protein is a small GTPase that contains both N-terminal and C-terminal guanine nucleotide-binding motifs. This protein is localized in the cilia and plays a role in cilia formation and in maintenance of cilia. Mutations in this gene are the cause of Joubert syndrome 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

Research Articles on ARL13B

1. Authors propose a so far unknown function of ARL13B in anchoring ciliary membrane proteins to the axoneme through the direct interaction of its G-domain with tubulin.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.