• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

STX4A Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6181738

MBS6181738 is an antibody targeting STX4A. Also known as STX4A (Syntaxin 4, STX4A, p35-2) (HRP). Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
STX4A, Monoclonal Antibody
Full Product Name
STX4A (Syntaxin 4, STX4A, p35-2) (HRP)
Product Gene Name
anti-STX4A antibody
Product Synonym Names
Syntaxin 4; STX4A; p35-2
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6A1
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified
Specificity
Recognizes STX4A.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
34.7 kDa (300aa), confirmed by MALDI-TOF
OMIM
186591
3D Structure
ModBase 3D Structure for Q12846
Immunogen
STX4A (NP_004595, 19aa-119aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVN
Conjugate
HRP

Product Categories/Family for anti-STX4A antibody

Antibodies; Syntaxin; Synaptotagmin; Synaptophysin
Applications Tested/Suitable for anti-STX4A antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-STX4A antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-STX4A antibody

STX4A monoclonal antibody (M02), clone 6A1. Western Blot analysis of STX4A expression in HeLa (Cat # L013V1).
Mouse Anti-STX4A Monoclonal Antibody – Cat# MBS6181738

Testing Data of anti-STX4A antibody

Detection limit for recombinant GST tagged STX4A is approximately 1ng/ml as a capture antibody.
Mouse Anti-STX4A Monoclonal Antibody, Testing Data – Cat# MBS6181738

Western Blot (WB) of anti-STX4A antibody

STX4A monoclonal antibody (M02), clone 6A1. Western Blot analysis of STX4A expression in NIH/3T3.
Mouse Anti-STX4A Monoclonal Antibody, Western Blot (WB) – Cat# MBS6181738

Western Blot (WB) of anti-STX4A antibody

STX4A monoclonal antibody (M02), clone 6A1. Western Blot analysis of STX4A expression in Raw 264.7.
Mouse Anti-STX4A Monoclonal Antibody, Western Blot (WB) – Cat# MBS6181738

Immunofluorescence (IF) of anti-STX4A antibody

Immunofluorescence of monoclonal antibody to STX4 on HeLa cell. [antibody concentration 10 ug/ml]
Mouse Anti-STX4A Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6181738

Immunofluorescence (IF) of anti-STX4A antibody

Immunofluorescence of monoclonal antibody to STX4 on HeLa cell. [antibody concentration 10 ug/ml]
Mouse Anti-STX4A Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6181738

Other Notes

Small volumes of anti-STX4A antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for STX4A. It may not necessarily be applicable to this product.

NCBI GI #
20149560
NCBI GeneID
6810
NCBI Accession #
NP_004595
UniProt Primary Accession #
Q12846
UniProt Secondary Accession #
Q15525; Q6FHE8; A8MXY0
UniProt Related Accession #
Q12846
GenBank Nucleotide #
NM_004604.4
NCBI Official Full Name
syntaxin-4 isoform 3
NCBI Official Synonym Full Names
syntaxin 4
NCBI Official Symbol
STX4
NCBI Official Synonym Symbols
STX4A; p35-2
UniProt Protein Name
Syntaxin-4
UniProt Synonym Protein Names
Renal carcinoma antigen NY-REN-31
UniProt Gene Name
STX4
UniProt Synonym Gene Names
STX4A
UniProt Entry Name
STX4_HUMAN
NCBI Protein Information
syntaxin-4

UniProt Comments for STX4A

STX4: a protein of the syntaxin/epimorphin family. Contains 1 t-SNARE coiled-coil homology domain. Potentially involved in docking of synaptic vesicles at presynaptic active zones. Interacts with SNAP23 and SNAP25BP. Found in a complex with VAMP8 and SNAP23 in pancreas.

Protein type: Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: extracellular space; specific granule; cell surface; lateral loop; basolateral plasma membrane; integral to membrane; dendritic spine; trans-Golgi network; cytosol; SNARE complex; synaptic vesicle; membrane; perinuclear region of cytoplasm; lamellipodium; plasma membrane; vacuole; synapse; intracellular; endosome

Molecular Function: sphingomyelin phosphodiesterase activator activity; SNAP receptor activity; SNARE binding; protein binding

Biological Process: positive regulation of catalytic activity; platelet activation; positive regulation of cell adhesion; organelle fusion; positive regulation of eosinophil degranulation; positive regulation of chemotaxis; positive regulation of immunoglobulin secretion; synaptic vesicle fusion to presynaptic membrane; regulation of exocytosis; intracellular protein transport; response to hydroperoxide; vesicle docking; positive regulation of cell proliferation; post-Golgi vesicle-mediated transport; blood coagulation; positive regulation of cell migration
Show more

Research Articles on STX4A

1. Data suggest MUNC18C is required for STX4-mediated invadopodium formation and tumor invasion of extracellular matrix; N-terminal STX4 fragment binds to MUNC18C and inhibits interactions of STX4 with synaptosome-associated protein 23 (SNAP23) and vesicle-associated membrane protein 2 (VAMP2). Fibrosarcoma/adenocarcinoma cell lines were used in these studies. (MUNC18C = syntaxin binding protein MUNC18C; STX4 = syntaxin 4)
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-STX4A antibody

 Reference Product  PubMed Publications
 VAMP3 antibody  >5 publications with STX4A and VAMP3
 SNAP23 antibody  >5 publications with STX4A and SNAP23
 STXBP4 antibody  >2 publications with STX4A and STXBP4
 VAMP2 antibody  >2 publications with STX4A and VAMP2
 VAMP4 antibody  >1 publications with STX4A and VAMP4
 VAMP8 antibody  >1 publications with STX4A and VAMP8
 STXBP3 antibody  >1 publications with STX4A and STXBP3

Pathways associated with anti-STX4A antibody

 Products by Pathway  Pathway Diagram
 Adaptive Immune System Pathway antibodies  Adaptive Immune System Pathway Diagram
 Antigen Processing-Cross Presentation Pathway antibodies  Antigen Processing-Cross Presentation Pathway Diagram
 Class I MHC Mediated Antigen Processing & Presentation Pathway antibodies  Class I MHC Mediated Antigen Processing & Presentation Pathway Diagram
 Clathrin Derived Vesicle Budding Pathway antibodies  Clathrin Derived Vesicle Budding Pathway Diagram
 Cytokine Signaling In Immune System Pathway antibodies  Cytokine Signaling In Immune System Pathway Diagram
 Disinhibition Of SNARE Formation Pathway antibodies  Disinhibition Of SNARE Formation Pathway Diagram
 ER-Phagosome Pathway antibodies  ER-Phagosome Pathway Diagram
 Hemostasis Pathway antibodies  Hemostasis Pathway Diagram
 Immune System Pathway antibodies  Immune System Pathway Diagram
 Insulin Signaling Pathway antibodies  Insulin Signaling Pathway Diagram

Organs/Tissues associated with anti-STX4A antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >2 publications with STX4A and Blood
 Brain Antibodies  >2 publications with STX4A and Brain
 Nerve Antibodies  >1 publications with STX4A and Nerve
 Kidney Antibodies  >1 publications with STX4A and Kidney
 Eye Antibodies  >1 publications with STX4A and Eye
 Liver Antibodies  >1 publications with STX4A and Liver
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000