Mouse Anti-PRG4 Monoclonal Antibody – Cat# MBS6181818

Detection limit for recombinant GST tagged PRG4 is approximately 3ng/ml as a capture antibody.

PRG4 Antibody – Mouse Monoclonal

Name: PRG4 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6181818
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6181818

MBS6181818 is an antibody targeting PRG4. Also known as PRG4 (Proteoglycan 4, CACP, FLJ32635, HAPO, JCAP, MSF, SZP, bG174L6.2) (HRP). Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

PRG4, Monoclonal Antibody

Full Product Name

PRG4 (Proteoglycan 4, CACP, FLJ32635, HAPO, JCAP, MSF, SZP, bG174L6.2) (HRP)

Product Gene Name

anti-PRG4 antibody

Product Synonym Names

Proteoglycan 4; CACP; FLJ32635; HAPO; JCAP; MSF; SZP; bG174L6.2

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

1D5

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

Purity/Purification

Purified

Specificity

Recognizes PRG4.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

OMIM

U70136 mRNA

3D Structure

ModBase 3D Structure for Q92954

Immunogen

PRG4 (NP_005798, 1305aa-1404aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP

Conjugate

HRP

Product Categories/Family for anti-PRG4 antibody

Antibodies; Proteins

Applications Tested/Suitable for anti-PRG4 antibody

Western Blot (WB)

Application Notes for anti-PRG4 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-PRG4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for PRG4. It may not necessarily be applicable to this product.

NCBI GI #

735997426

NCBI Accession #

NP_005798

UniProt Primary Accession #

Q92954

GenBank Nucleotide #

NP_005798.3

NCBI Official Full Name

proteoglycan 4 isoform A preproprotein

UniProt Protein Name

Proteoglycan 4

UniProt Synonym Protein Names

Lubricin; Megakaryocyte-stimulating factor; Superficial zone proteoglycan

Protein Family

Proteoglycan

UniProt Gene Name

PRG4

UniProt Synonym Gene Names

MSF; SZP

UniProt Comments for PRG4

PRG4: Plays a role in boundary lubrication within articulating joints. Prevents protein deposition onto cartilage from synovial fluid by controlling adhesion-dependent synovial growth and inhibiting the adhesion of synovial cells to the cartilage surface. Defects in PRG4 are the cause of camptodactyly- arthropathy-coxa vara-pericarditis syndrome (CACP); also known as Jacobs syndrome. CACP is an autosomal recessive disorder. Individuals with CACP have normal appearing joints at birth but with advancing age develop joint failure associated with noninflammatory synoviocyte hyperplasia and subintimal fibrosis of the synovial capsule. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1q31.1

Cellular Component: extracellular matrix

Molecular Function: polysaccharide binding; scavenger receptor activity

Biological Process: cell proliferation; immune response; receptor-mediated endocytosis

Disease: Camptodactyly-arthropathy-coxa Vara-pericarditis Syndrome

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PRG4 antibody

Reference Product	PubMed Publications
TGFB1 antibody	>15 publications with PRG4 and TGFB1
ACAN antibody	>2 publications with PRG4 and ACAN

Diseases associated with anti-PRG4 antibody

Disease Name	Pubmed Publications
Pericarditis Antibodies	>14 publications with PRG4 and Pericarditis
Inflammation Antibodies	>8 publications with PRG4 and Inflammation
Necrosis Antibodies	>7 publications with PRG4 and Necrosis
Jacobs syndrome Antibodies	>6 publications with PRG4 and Jacobs syndrome
Disease Models, Animal Antibodies	>6 publications with PRG4 and Disease Models, Animal
Hyperplasia Antibodies	>4 publications with PRG4 and Hyperplasia
Contracture Antibodies	>3 publications with PRG4 and Contracture
Hypertrophy Antibodies	>2 publications with PRG4 and Hypertrophy
Nervous System Diseases Antibodies	>2 publications with PRG4 and Nervous System Diseases
Kidney Diseases Antibodies	>1 publications with PRG4 and Kidney Diseases

Organs/Tissues associated with anti-PRG4 antibody

Organ/Tissue Name	Pubmed Publications
Connective Tissue Antibodies	>18 publications with PRG4 and Connective Tissue
Embryonic Tissue Antibodies	>5 publications with PRG4 and Embryonic Tissue
Vascular Antibodies	>5 publications with PRG4 and Vascular
Eye Antibodies	>5 publications with PRG4 and Eye
Liver Antibodies	>4 publications with PRG4 and Liver
Lung Antibodies	>4 publications with PRG4 and Lung
Heart Antibodies	>3 publications with PRG4 and Heart
Adipose Tissue Antibodies	>2 publications with PRG4 and Adipose Tissue
Brain Antibodies	>2 publications with PRG4 and Brain
Thymus Antibodies	>1 publications with PRG4 and Thymus