Mouse Anti-KCNMB3 Monoclonal Antibody – Cat# MBS6182225

Detection limit for recombinant GST tagged KCNMB3 is 0.3 ng/ml as a capture antibody.

KCNMB3 Antibody – Mouse Monoclonal

Name: KCNMB3 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6182225
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6182225

MBS6182225 is an antibody targeting KCNMB3. Also known as KCNMB3 (Potassium Large conductance Calcium-Activated Channel, Subfamily M beta Member 3, KCNMB2, KCNMBL) (HRP). Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

KCNMB3, Monoclonal Antibody

Full Product Name

KCNMB3 (Potassium Large conductance Calcium-Activated Channel, Subfamily M beta Member 3, KCNMB2, KCNMBL) (HRP)

Product Gene Name

anti-KCNMB3 antibody

Product Synonym Names

Potassium Large conductance Calcium-Activated Channel; Subfamily M beta Member 3; KCNMB2; KCNMBL

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

1F1

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

Purity/Purification

Purified

Specificity

Recognizes KCNMB3.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

31kDa

OMIM

AF139471 mRNA

3D Structure

ModBase 3D Structure for Q9NPA1

Immunogen

KCNMB3 (NP_741979, 82aa-181aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

FMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNG

Conjugate

HRP

Product Categories/Family for anti-KCNMB3 antibody

Antibodies; Ion Channel

Applications Tested/Suitable for anti-KCNMB3 antibody

Western Blot (WB)

Application Notes for anti-KCNMB3 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-KCNMB3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for KCNMB3. It may not necessarily be applicable to this product.

NCBI GI #

25952099

NCBI GeneID

27094

NCBI Accession #

NP_741979

UniProt Primary Accession #

Q9NPA1

GenBank Nucleotide #

NM_171828

NCBI Official Full Name

calcium-activated potassium channel subunit beta-3 isoform a

NCBI Official Synonym Full Names

potassium calcium-activated channel subfamily M regulatory beta subunit 3

NCBI Official Symbol

KCNMB3

NCBI Official Synonym Symbols

HBETA3; KCNMB2; KCNMBL; BKBETA3; SLOBETA3; SLO-BETA-3; K(VCA)BETA-3

UniProt Protein Name

Calcium-activated potassium channel subunit beta-3

UniProt Synonym Protein Names

BK channel subunit beta-3; BKbeta3; Hbeta3; Calcium-activated potassium channel, subfamily M subunit beta-3; Charybdotoxin receptor subunit beta-3; K(VCA)beta-3; Maxi K channel subunit beta-3; Slo-beta-3

Protein Family

Calcium-activated potassium channel

UniProt Gene Name

KCNMB3

UniProt Synonym Gene Names

KCNMB2; KCNMBL; BKbeta3; Hbeta3

NCBI Protein Information

calcium-activated potassium channel subunit beta-3

NCBI Summary for KCNMB3

MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which may partially inactivate or slightly decrease the activation time of MaxiK alpha subunit currents. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 22. [provided by RefSeq, Jul 2009]

UniProt Comments for KCNMB3

Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Alters the functional properties of the current expressed by the KCNMA1 channel. Isoform 2, isoform 3 and isoform 4 partially inactivate the current of KCNBMA. Isoform 4 induces a fast and incomplete inactivation of KCNMA1 channel that is detectable only at large depolarizations. In contrast, isoform 1 does not induce detectable inactivation of KCNMA1. Two or more subunits of KCNMB3 are required to block the KCNMA1 tetramer.

Research Articles on KCNMB3

1. Single-nucleotide polymorphism in KCNMB3 gene is associated with Insulin Resistance.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.