Mouse Anti-MED8 Monoclonal Antibody – Cat# MBS6182682

MED8 Antibody – Mouse Monoclonal

Name: MED8 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6182682
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6182682

MBS6182682 is an antibody targeting MED8. Also known as MED8 (Mediator Complex Subunit 8, ARC32, MGC17544, MGC19641) (HRP). Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

MED8, Monoclonal Antibody

Full Product Name

MED8 (Mediator Complex Subunit 8, ARC32, MGC17544, MGC19641) (HRP)

Product Gene Name

anti-MED8 antibody

Product Synonym Names

Mediator Complex Subunit 8; ARC32; MGC17544; MGC19641

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

100000

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

Purity/Purification

Purified

Specificity

Recognizes MED8.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

19,002 Da

OMIM

607956

3D Structure

ModBase 3D Structure for Q96G25

Immunogen

MED8 (NP_443109, 1aa-59aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCS

Conjugate

HRP

Product Categories/Family for anti-MED8 antibody

Antibodies; Enzymes; Polymerase

Applications Tested/Suitable for anti-MED8 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-MED8 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-MED8 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for MED8. It may not necessarily be applicable to this product.

NCBI GI #

155030190

NCBI GeneID

112950

NCBI Accession #

NP_443109

UniProt Primary Accession #

Q96G25

UniProt Secondary Accession #

Q5JUY8; Q96FQ4; A9IZ91; A9IZ92

UniProt Related Accession #

Q96G25

GenBank Nucleotide #

NM_052877

NCBI Official Full Name

mediator of RNA polymerase II transcription subunit 8 isoform 3

NCBI Official Synonym Full Names

mediator complex subunit 8

NCBI Official Symbol

MED8

NCBI Official Synonym Symbols

ARC32

UniProt Protein Name

Mediator of RNA polymerase II transcription subunit 8

UniProt Synonym Protein Names

Activator-recruited cofactor 32 kDa component; ARC32; Mediator complex subunit 8

Protein Family

Mediator of RNA polymerase II transcription

UniProt Gene Name

MED8

UniProt Synonym Gene Names

ARC32

UniProt Entry Name

MED8_HUMAN

NCBI Protein Information

mediator of RNA polymerase II transcription subunit 8; activator-recruited cofactor 32 kDa component; mediator of RNA polymerase II transcription subunit MED8

UniProt Comments for MED8

MED8: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. May play a role as a target recruitment subunit in E3 ubiquitin-protein ligase complexes and thus in ubiquitination and subsequent proteasomal degradation of target proteins. Belongs to the Mediator complex subunit 8 family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 1p34.2

Cellular Component: nucleoplasm; Srb-mediator complex

Molecular Function: protein binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; protein ubiquitination; gene expression

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-MED8 antibody

Reference Product	PubMed Publications
MED17 antibody	>4 publications with MED8 and MED17
MED31 antibody	>1 publications with MED8 and MED31

Pathways associated with anti-MED8 antibody

Products by Pathway	Pathway Diagram
Developmental Biology Pathway antibodies	Developmental Biology Pathway Diagram
Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway antibodies	Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway Diagram
Gene Expression Pathway antibodies	Gene Expression Pathway Diagram
Generic Transcription Pathway antibodies	Generic Transcription Pathway Diagram
Herpes Simplex Infection Pathway antibodies	Herpes Simplex Infection Pathway Diagram
Herpes Simplex Infection Pathway antibodies	Herpes Simplex Infection Pathway Diagram
Metabolism Pathway antibodies	Metabolism Pathway Diagram
Metabolism Of Lipids And Lipoproteins Pathway antibodies	Metabolism Of Lipids And Lipoproteins Pathway Diagram
PPARA Activates Gene Expression Pathway antibodies	PPARA Activates Gene Expression Pathway Diagram
Regulation Of Lipid Metabolism By Peroxisome Proliferator-activated Receptor Alpha (PPARalpha) Pathway antibodies	Regulation Of Lipid Metabolism By Peroxisome Proliferator-activated Receptor Alpha (PPARalpha) Pathway Diagram

Diseases associated with anti-MED8 antibody

Disease Name	Pubmed Publications
Hypertension Antibodies	>1 publications with MED8 and Hypertension

Organs/Tissues associated with anti-MED8 antibody

Organ/Tissue Name	Pubmed Publications
Liver Antibodies	>3 publications with MED8 and Liver
Vascular Antibodies	>1 publications with MED8 and Vascular
Muscle Antibodies	>1 publications with MED8 and Muscle
Embryonic Tissue Antibodies	>1 publications with MED8 and Embryonic Tissue
Brain Antibodies	>1 publications with MED8 and Brain