Mouse Anti-CTNNBIP1 Monoclonal Antibody – Cat# MBS6182808

Detection limit for recombinant GST tagged CTNNBIP1 is 0.03ng/ml as a capture antibody.

CTNNBIP1 Antibody – Mouse Monoclonal

Name: CTNNBIP1 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6182808
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6182808

MBS6182808 is an antibody targeting CTNNBIP1. Also known as CTNNBIP1 (Catenin, beta Interacting Protein 1, ICAT, MGC15093) (HRP). Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

CTNNBIP1, Monoclonal Antibody

Full Product Name

CTNNBIP1 (Catenin, beta Interacting Protein 1, ICAT, MGC15093) (HRP)

Product Gene Name

anti-CTNNBIP1 antibody

Product Synonym Names

Catenin; beta Interacting Protein 1; ICAT; MGC15093

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

3B3

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

Purity/Purification

Purified

Specificity

Recognizes human CTNNBIP1.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

11.3kDa (101a) confirmed by MALDI-TOF

OMIM

607758

3D Structure

ModBase 3D Structure for Q9NSA3

Immunogen

Partial recombinant protein corresponding to aa1-81 from human CTNNBIP1 with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ

Conjugate

HRP

Product Categories/Family for anti-CTNNBIP1 antibody

Antibodies; Catenin

Applications Tested/Suitable for anti-CTNNBIP1 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-CTNNBIP1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-CTNNBIP1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for CTNNBIP1. It may not necessarily be applicable to this product.

NCBI GI #

9910390

NCBI GeneID

56998

NCBI Accession #

NP_064633

UniProt Primary Accession #

Q9NSA3

UniProt Secondary Accession #

Q5T4V2

UniProt Related Accession #

Q9NSA3

GenBank Nucleotide #

NM_020248.2

NCBI Official Full Name

beta-catenin-interacting protein 1

NCBI Official Synonym Full Names

catenin beta interacting protein 1

NCBI Official Symbol

CTNNBIP1

NCBI Official Synonym Symbols

ICAT

UniProt Protein Name

Beta-catenin-interacting protein 1

UniProt Synonym Protein Names

Inhibitor of beta-catenin and Tcf-4

Protein Family

Beta-catenin-interacting protein

UniProt Gene Name

CTNNBIP1

UniProt Synonym Gene Names

ICAT

UniProt Entry Name

CNBP1_HUMAN

NCBI Protein Information

beta-catenin-interacting protein 1

NCBI Summary for CTNNBIP1

The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

UniProt Comments for CTNNBIP1

CTNNBIP1: Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway. Belongs to the CTNNBIP1 family.

Protein type: Cell development/differentiation; Inhibitor

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: nucleoplasm; cytoplasm; nucleus; beta-catenin destruction complex; cytosol

Molecular Function: protein binding; beta-catenin binding

Biological Process: anterior/posterior pattern formation; positive regulation of monocyte differentiation; positive regulation of osteoblast differentiation; Wnt receptor signaling pathway; negative regulation of Wnt receptor signaling pathway; ureteric bud branching; negative regulation of smooth muscle cell proliferation; negative regulation of transcription factor activity; negative regulation of protein binding; regulation of vascular permeability during acute inflammatory response; negative regulation of DNA binding

Research Articles on CTNNBIP1

1. The present work aims to investigate the relationship between the expression of AEG-1(astrocyte elevated gene-1), b-FGF(basic-fibroblast growth factor), beta-catenin, Ki-67, TNF-alpha (tumor necrosis factor-alfa) other prognostic parameters in DC (Ductal Carcinomas) and ductal intraepithelial neoplasm. We found a relationship between these factors.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-CTNNBIP1 antibody

Reference Product	PubMed Publications
CTNNB1 antibody	>31 publications with CTNNBIP1 and CTNNB1
CLSTN1 antibody	>2 publications with CTNNBIP1 and CLSTN1
UBIAD1 antibody	>1 publications with CTNNBIP1 and UBIAD1

Pathways associated with anti-CTNNBIP1 antibody

Products by Pathway	Pathway Diagram
Deactivation Of The Beta-catenin Transactivating Complex Pathway antibodies	Deactivation Of The Beta-catenin Transactivating Complex Pathway Diagram
Regulation Of Wnt-mediated Beta Catenin Signaling And Target Gene Transcription Pathway antibodies	Regulation Of Wnt-mediated Beta Catenin Signaling And Target Gene Transcription Pathway Diagram
Signal Transduction Pathway antibodies	Signal Transduction Pathway Diagram
Signaling By Wnt Pathway antibodies	Signaling By Wnt Pathway Diagram
TCF Dependent Signaling In Response To WNT Pathway antibodies	TCF Dependent Signaling In Response To WNT Pathway Diagram
Wnt Signaling Pathway antibodies	Wnt Signaling Pathway Diagram
Wnt Signaling Pathway antibodies	Wnt Signaling Pathway Diagram

Diseases associated with anti-CTNNBIP1 antibody

Disease Name	Pubmed Publications
Liver Neoplasms Antibodies	>3 publications with CTNNBIP1 and Liver Neoplasms
Liver Diseases Antibodies	>2 publications with CTNNBIP1 and Liver Diseases
Carcinoma, Hepatocellular Antibodies	>2 publications with CTNNBIP1 and Carcinoma, Hepatocellular
Congenital Abnormalities Antibodies	>1 publications with CTNNBIP1 and Congenital Abnormalities
Embryo Loss Antibodies	>1 publications with CTNNBIP1 and Embryo Loss
Hepatomegaly Antibodies	>1 publications with CTNNBIP1 and Hepatomegaly
Disease Models, Animal Antibodies	>1 publications with CTNNBIP1 and Disease Models, Animal
Fibrosis Antibodies	>1 publications with CTNNBIP1 and Fibrosis
Abnormalities, Multiple Antibodies	>1 publications with CTNNBIP1 and Abnormalities, Multiple
Necrosis Antibodies	>1 publications with CTNNBIP1 and Necrosis

Organs/Tissues associated with anti-CTNNBIP1 antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>7 publications with CTNNBIP1 and Blood
Kidney Antibodies	>6 publications with CTNNBIP1 and Kidney
Liver Antibodies	>5 publications with CTNNBIP1 and Liver
Embryonic Tissue Antibodies	>3 publications with CTNNBIP1 and Embryonic Tissue
Eye Antibodies	>3 publications with CTNNBIP1 and Eye
Connective Tissue Antibodies	>3 publications with CTNNBIP1 and Connective Tissue
Bone Antibodies	>3 publications with CTNNBIP1 and Bone
Vascular Antibodies	>2 publications with CTNNBIP1 and Vascular
Uncharacterized Tissue Antibodies	>1 publications with CTNNBIP1 and Uncharacterized Tissue
Prostate Antibodies	>1 publications with CTNNBIP1 and Prostate