• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

FNBP1L Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6183156

MBS6183156 is an antibody targeting FNBP1L. Also known as FNBP1L (Formin Binding Protein 1-like, C1orf39, TOCA1) (HRP). Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
FNBP1L, Monoclonal Antibody
Full Product Name
FNBP1L (Formin Binding Protein 1-like, C1orf39, TOCA1) (HRP)
Product Gene Name
anti-FNBP1L antibody
Product Synonym Names
Formin Binding Protein 1-like; C1orf39; TOCA1
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1000000
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified
Specificity
Recognizes FNBP1L.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
69,894 Da
OMIM
608848
3D Structure
ModBase 3D Structure for Q5T0N5
Immunogen
FNBP1L (NP_060207.2, 175aa-239aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERK
Conjugate
HRP

Product Categories/Family for anti-FNBP1L antibody

Antibodies; Binding Proteins
Applications Tested/Suitable for anti-FNBP1L antibody
Western Blot (WB)
Application Notes for anti-FNBP1L antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-FNBP1L antibody

FNBP1L monoclonal antibody (M01), clone 1E6. Western Blot analysis of FNBP1L expression in HepG2.
Mouse Anti-FNBP1L Monoclonal Antibody – Cat# MBS6183156

Testing Data of anti-FNBP1L antibody

Detection limit for recombinant GST tagged FNBP1L is 1 ng/ml as a capture antibody.
Mouse Anti-FNBP1L Monoclonal Antibody, Testing Data – Cat# MBS6183156

Other Notes

Small volumes of anti-FNBP1L antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for FNBP1L. It may not necessarily be applicable to this product.

NCBI GI #
41581463
NCBI GeneID
54874
NCBI Accession #
NP_060207.2
UniProt Primary Accession #
Q5T0N5
UniProt Secondary Accession #
Q5T0N6; Q6B097; Q6P653; Q6R4Q4; Q9NXG1; J3QSS4
UniProt Related Accession #
Q5T0N5
GenBank Nucleotide #
NM_017737.4
NCBI Official Full Name
formin-binding protein 1-like isoform 2
NCBI Official Synonym Full Names
formin binding protein 1-like
NCBI Official Symbol
FNBP1L
NCBI Official Synonym Symbols
TOCA1; C1orf39
UniProt Protein Name
Formin-binding protein 1-like
UniProt Synonym Protein Names
Transducer of Cdc42-dependent actin assembly protein 1; Toca-1
Protein Family
Formin-binding protein
UniProt Gene Name
FNBP1L
UniProt Synonym Gene Names
C1orf39; TOCA1; Toca-1
UniProt Entry Name
FBP1L_HUMAN
NCBI Protein Information
formin-binding protein 1-like; toca-1; transducer of Cdc42-dependent actin assembly 1; transducer of Cdc42-dependent actin assembly protein 1

NCBI Summary for FNBP1L

The protein encoded by this gene binds to both CDC42 and N-WASP. This protein promotes CDC42-induced actin polymerization by activating the N-WASP-WIP complex and, therefore, is involved in a pathway that links cell surface signals to the actin cytoskeleton. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for FNBP1L

FNBP1L: Required to coordinate membrane tubulation with reorganization of the actin cytoskeleton during endocytosis. May bind to lipids such as phosphatidylinositol 4,5-bisphosphate and phosphatidylserine and promote membrane invagination and the formation of tubules. Also promotes CDC42-induced actin polymerization by activating the WASL/N-WASP-WASPIP/WIP complex, the predominant form of WASL/N-WASP in cells. Actin polymerization may promote the fission of membrane tubules to form endocytic vesicles. Essential for autophagy of intracellular bacterial pathogens. Belongs to the FNBP1 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 1p22.1

Cellular Component: cytoskeleton; cytoplasmic membrane-bound vesicle; cytoplasm; plasma membrane; cell cortex

Molecular Function: protein binding; lipid binding

Biological Process: positive regulation of filopodium formation; vesicle transport along actin filament; vesicle organization and biogenesis; membrane invagination; cilium biogenesis; autophagy; membrane budding
Show more

Research Articles on FNBP1L

1. GWAS results show that the aggregate effects of common SNPs explain 22-46% of phenotypic variation in childhood intelligence in the three largest cohorts; FNBP1L was also significantly associated with childhood intelligence

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-FNBP1L antibody

 Reference Product  PubMed Publications
 CDC42 antibody  >14 publications with FNBP1L and CDC42
 WASL antibody  >4 publications with FNBP1L and WASL
 ATG3 antibody  >1 publications with FNBP1L and ATG3

Diseases associated with anti-FNBP1L antibody

 Disease Name  Pubmed Publications
 Neoplasm Invasiveness Antibodies  >3 publications with FNBP1L and Neoplasm Invasiveness
 Blood Coagulation Disorders Antibodies  >2 publications with FNBP1L and Blood Coagulation Disorders
 Neoplasm Metastasis Antibodies  >2 publications with FNBP1L and Neoplasm Metastasis
 Breast Neoplasms Antibodies  >2 publications with FNBP1L and Breast Neoplasms
 Neoplasms, Experimental Antibodies  >1 publications with FNBP1L and Neoplasms, Experimental
 Edema Antibodies  >1 publications with FNBP1L and Edema
 Skin Neoplasms Antibodies  >1 publications with FNBP1L and Skin Neoplasms
 Adenocarcinoma Antibodies  >1 publications with FNBP1L and Adenocarcinoma
 Lung Neoplasms Antibodies  >1 publications with FNBP1L and Lung Neoplasms

Organs/Tissues associated with anti-FNBP1L antibody

 Organ/Tissue Name  Pubmed Publications
 Nerve Antibodies  >4 publications with FNBP1L and Nerve
 Brain Antibodies  >3 publications with FNBP1L and Brain
 Lung Antibodies  >1 publications with FNBP1L and Lung
 Blood Antibodies  >1 publications with FNBP1L and Blood
 Skin Antibodies  >1 publications with FNBP1L and Skin
 Muscle Antibodies  >1 publications with FNBP1L and Muscle
 Eye Antibodies  >1 publications with FNBP1L and Eye
 Embryonic Tissue Antibodies  >1 publications with FNBP1L and Embryonic Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000