• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

MAP4K1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6183395

MBS6183395 is an antibody targeting MAP4K1. Also known as MAP4K1 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1, HPK1) (HRP). Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
MAP4K1, Monoclonal Antibody
Full Product Name
MAP4K1 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1, HPK1) (HRP)
Product Gene Name
anti-MAP4K1 antibody
Product Synonym Names
Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1; HPK1
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G6
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified
Specificity
Recognizes human MAP4K1.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
601983
3D Structure
ModBase 3D Structure for Q92918
Immunogen
Partial recombinant protein corresponding to aa278-377 of human MAP4K1 (NP_009112) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GLNRGLILDLLDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESS
Conjugate
HRP

Product Categories/Family for anti-MAP4K1 antibody

Antibodies; Protein Kinases
Applications Tested/Suitable for anti-MAP4K1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-MAP4K1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-MAP4K1 antibody

Western Blot analysis of MAP4K1 expression in Jurkat using.
Mouse Anti-MAP4K1 Monoclonal Antibody – Cat# MBS6183395

Western Blot (WB) of anti-MAP4K1 antibody

Western Blot detection against Immunogen (36.63kD).
Mouse Anti-MAP4K1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6183395

Testing Data of anti-MAP4K1 antibody

Detection limit for is 0.03ng/ml as a capture antibody.
Mouse Anti-MAP4K1 Monoclonal Antibody, Testing Data – Cat# MBS6183395

Other Notes

Small volumes of anti-MAP4K1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for MAP4K1. It may not necessarily be applicable to this product.

NCBI GI #
6005810
NCBI GeneID
11184
NCBI Accession #
NP_009112
UniProt Primary Accession #
Q92918
UniProt Related Accession #
Q92918
GenBank Nucleotide #
NP_009112.1
NCBI Official Full Name
mitogen-activated protein kinase kinase kinase kinase 1 isoform 2
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase kinase kinase 1
NCBI Official Symbol
MAP4K1
NCBI Official Synonym Symbols
HPK1
UniProt Protein Name
Mitogen-activated protein kinase kinase kinase kinase 1
UniProt Synonym Protein Names
Hematopoietic progenitor kinase; MAPK/ERK kinase kinase kinase 1
Protein Family
Mitogen-activated protein kinase kinase kinase kinase
UniProt Gene Name
MAP4K1
UniProt Synonym Gene Names
HPK1; MEK kinase kinase 1; MEKKK 1
UniProt Entry Name
M4K1_HUMAN
NCBI Protein Information
mitogen-activated protein kinase kinase kinase kinase 1

UniProt Comments for MAP4K1

HPK1: a protein kinase of the STE20 family. Expressed primarily in hematopoietic organs, including bone marrow, spleen and thymus. Also expressed at very low levels in lung, kidney, mammary glands and small intestine. May play a role in hematopoietic lineage decisions and growth regulation. Positively regulated by PGE2 and a negative regulator of PGE2-induced FOS gene transcription.

Protein type: EC 2.7.11.1; Protein kinase, STE; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; STE group; STE20 family; KHS subfamily

Chromosomal Location of Human Ortholog: 19q13.1-q13.4

Cellular Component: membrane; cytoplasm

Molecular Function: protein serine/threonine kinase activity; protein binding; MAP kinase kinase kinase kinase activity; ATP binding; protein kinase activity

Biological Process: cell proliferation; peptidyl-serine phosphorylation; protein amino acid autophosphorylation; activation of MAPKKK activity; response to stress; protein amino acid phosphorylation; activation of JNK activity
Show more

Research Articles on MAP4K1

1. Interactions between HPK1 and its adaptor proteins related to immunity has been discussed (Review).

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-MAP4K1 antibody

 Reference Product  PubMed Publications
 EGFR antibody  >1 publications with MAP4K1 and EGFR
 GRB2 antibody  >1 publications with MAP4K1 and GRB2
 CRKL antibody  >1 publications with MAP4K1 and CRKL
 CRK antibody  >1 publications with MAP4K1 and CRK

Pathways associated with anti-MAP4K1 antibody

 Products by Pathway  Pathway Diagram
 B Cell Receptor Signaling Pathway antibodies  B Cell Receptor Signaling Pathway Diagram
 BCR Signaling Pathway antibodies  BCR Signaling Pathway Diagram
 Insulin Signaling Pathway antibodies  Insulin Signaling Pathway Diagram
 JNK Signaling In The CD4+ TCR Pathway antibodies  JNK Signaling In The CD4+ TCR Pathway Diagram
 MAPK Signaling Pathway antibodies  MAPK Signaling Pathway Diagram
 MAPK Signaling Pathway antibodies  MAPK Signaling Pathway Diagram
 MAPK Signaling Pathway antibodies  MAPK Signaling Pathway Diagram
 Signaling Events Mediated By Stem Cell Factor Receptor (c-Kit) Pathway antibodies  Signaling Events Mediated By Stem Cell Factor Receptor (c-Kit) Pathway Diagram
 Signaling Of Hepatocyte Growth Factor Receptor Pathway antibodies  Signaling Of Hepatocyte Growth Factor Receptor Pathway Diagram
 T Cell Receptor Signaling Pathway antibodies  T Cell Receptor Signaling Pathway Diagram

Diseases associated with anti-MAP4K1 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >4 publications with MAP4K1 and Neoplasms
 Urinary Bladder Neoplasms Antibodies  >1 publications with MAP4K1 and Urinary Bladder Neoplasms

Organs/Tissues associated with anti-MAP4K1 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >2 publications with MAP4K1 and Blood
 Brain Antibodies  >1 publications with MAP4K1 and Brain
 Intestine Antibodies  >1 publications with MAP4K1 and Intestine
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000