Mouse Anti-MAMLD1 Monoclonal Antibody – Cat# MBS6183535

Detection limit for recombinant GST tagged MAMLD1 is 0.3 ng/ml as a capture antibody.

MAMLD1 Antibody – Mouse Monoclonal

Name: MAMLD1 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6183535
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6183535

MBS6183535 is an antibody targeting MAMLD1. Also known as MAMLD1 (Mastermind-like Domain Containing 1, CG1, CXorf6, F18) (HRP). Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

MAMLD1, Monoclonal Antibody

Full Product Name

MAMLD1 (Mastermind-like Domain Containing 1, CG1, CXorf6, F18) (HRP)

Product Gene Name

anti-MAMLD1 antibody

Product Synonym Names

Mastermind-like Domain Containing 1; CG1; CXorf6; F18

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

4B4

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

Purity/Purification

Purified

Specificity

Recognizes MAMLD1.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

74kDa

OMIM

300120

3D Structure

ModBase 3D Structure for Q13495

Immunogen

MAMLD1 (NP_005482, 603aa-701aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

SPSNITHVDKACKLGEARHPQVSLGRQPPSCQALGSESFLPGSSFAHELARVTSSYSTSEAAPWGSWDPKAWRQVPAPLLPSCDATARGTEIRSYGNDP

Conjugate

HRP

Product Categories/Family for anti-MAMLD1 antibody

Antibodies; Transcription Factors

Applications Tested/Suitable for anti-MAMLD1 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-MAMLD1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-MAMLD1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for MAMLD1. It may not necessarily be applicable to this product.

NCBI GI #

294489310

NCBI GeneID

10046

NCBI Accession #

NP_005482

UniProt Primary Accession #

Q13495

UniProt Related Accession #

Q13495

GenBank Nucleotide #

NM_005491

NCBI Official Full Name

mastermind-like domain-containing protein 1 isoform 3

NCBI Official Synonym Full Names

mastermind like domain containing 1

NCBI Official Symbol

MAMLD1

NCBI Official Synonym Symbols

CG1; F18; HYSP2; CXorf6

UniProt Protein Name

Mastermind-like domain-containing protein 1

UniProt Synonym Protein Names

F18; Protein CG1

Protein Family

Mastermind-like domain-containing protein

UniProt Gene Name

MAMLD1

UniProt Synonym Gene Names

CG1; CXorf6

UniProt Entry Name

MAMD1_HUMAN

NCBI Protein Information

mastermind-like domain-containing protein 1

NCBI Summary for MAMLD1

This gene encodes a mastermind-like domain containing protein. This protein may function as a transcriptional co-activator. Mutations in this gene are the cause of X-linked hypospadias type 2. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010]

UniProt Comments for MAMLD1

MAMLD1: Transactivates the HES3 promoter independently of NOTCH proteins. HES3 is a non-canonical NOTCH target gene which lacks binding sites for RBPJ. Defects in MAMLD1 are a cause of X-linked hypospadias type 2 (HYSP2). Hypospadias is a common malformation in which the urethra opens on the ventral side of the penis. It is considered a complex disorder with both genetic and environmental factors involved in the pathogenesis. Hypospadias can occur alone on an apparently multifactorial basis or as part of syndromes. Belongs to the mastermind family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: nucleus

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent; male gonad development

Disease: Hypospadias 2, X-linked

Research Articles on MAMLD1

1. Study provides evidence that MAMLD1 transcription is up-regulated in patients with 46,XX testicular and ovotesticular disorders of sex development.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-MAMLD1 antibody

Reference Product	PubMed Publications
HES3 antibody	>5 publications with MAMLD1 and HES3
CYP17A1 antibody	>3 publications with MAMLD1 and CYP17A1
MTM1 antibody	>1 publications with MAMLD1 and MTM1

Pathways associated with anti-MAMLD1 antibody

Products by Pathway	Pathway Diagram
Constitutive Signaling By NOTCH1 HD+PEST Domain Mutants Pathway antibodies	Constitutive Signaling By NOTCH1 HD+PEST Domain Mutants Pathway Diagram
Constitutive Signaling By NOTCH1 PEST Domain Mutants Pathway antibodies	Constitutive Signaling By NOTCH1 PEST Domain Mutants Pathway Diagram
Disease Pathway antibodies	Disease Pathway Diagram
FBXW7 Mutants And NOTCH1 In Cancer Pathway antibodies	FBXW7 Mutants And NOTCH1 In Cancer Pathway Diagram
Gene Expression Pathway antibodies	Gene Expression Pathway Diagram
Generic Transcription Pathway antibodies	Generic Transcription Pathway Diagram
NOTCH1 Intracellular Domain Regulates Transcription Pathway antibodies	NOTCH1 Intracellular Domain Regulates Transcription Pathway Diagram
NOTCH2 Intracellular Domain Regulates Transcription Pathway antibodies	NOTCH2 Intracellular Domain Regulates Transcription Pathway Diagram
Notch-HLH Transcription Pathway antibodies	Notch-HLH Transcription Pathway Diagram
Pre-NOTCH Expression And Processing Pathway antibodies	Pre-NOTCH Expression And Processing Pathway Diagram

Diseases associated with anti-MAMLD1 antibody

Disease Name	Pubmed Publications
Hypospadias Antibodies	>16 publications with MAMLD1 and Hypospadias
Genital Diseases, Male Antibodies	>13 publications with MAMLD1 and Genital Diseases, Male
Prenatal Exposure Delayed Effects Antibodies	>2 publications with MAMLD1 and Prenatal Exposure Delayed Effects
Ovarian Diseases Antibodies	>1 publications with MAMLD1 and Ovarian Diseases
Hypertension Antibodies	>1 publications with MAMLD1 and Hypertension
Nervous System Diseases Antibodies	>1 publications with MAMLD1 and Nervous System Diseases
Hypospadias 1, X-Linked Antibodies	>1 publications with MAMLD1 and Hypospadias 1, X-Linked

Organs/Tissues associated with anti-MAMLD1 antibody

Organ/Tissue Name	Pubmed Publications
Testis Antibodies	>5 publications with MAMLD1 and Testis