Mouse Anti-PAX8 Monoclonal Antibody – Cat# MBS6183848

Detection limit for recombinant GST tagged PAX8 is approximately 1ng/ml as a capture antibody.

PAX8 Antibody – Mouse Monoclonal

Name: PAX8 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6183848
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6183848

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

PAX8, Monoclonal Antibody

Full Product Name

PAX8 (Paired Box 8) (PE)

Product Gene Name

anti-PAX8 antibody

Product Synonym Names

Paired Box 8

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

3A10

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

Purity/Purification

Purified

Specificity

Recognizes PAX8.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunogen

PAX8 (AAH01060, 1aa-450aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL

Conjugate

Product Categories/Family for anti-PAX8 antibody

Antibodies; Transcription Factors

Applications Tested/Suitable for anti-PAX8 antibody

Western Blot (WB)

Application Notes for anti-PAX8 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-PAX8 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PAX8 purchase

MBS6183848 is an antibody targeting PAX8. Also known as PAX8 (Paired Box 8) (PE). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for PAX8. It may not necessarily be applicable to this product.

NCBI GI #

12654465

NCBI GeneID

7849

NCBI Accession #

AAH01060

UniProt Related Accession #

Q06710

NCBI Official Full Name

Paired box 8

NCBI Official Synonym Full Names

paired box 8

NCBI Official Symbol

PAX8

Protein Family

Paired box protein

NCBI Protein Information

paired box protein Pax-8

NCBI Summary for PAX8

This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Mar 2010]

Research Articles on PAX8

1. immunophenotyping with CLDN18, CDH17, and PAX8 might improve the diagnostic accuracy of histopathological classifications of endocervical adenocarcinoma

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.