• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

CELSR3 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6189405

CELSR3 is an Orphan-U GPCR with an unknown ligand. In mouse, this gene is expressed during development at sites of active neurogenesis and in adult mice and rats in brain, spinal cord, dorsal root ganglion, and eye. ESTs have been isolated from human… More details

$960 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
CELSR3, Monoclonal Antibody
Full Product Name
CELSR3 (Cadherin EGF LAG Seven-pass G-type Receptor 3, Cadherin Family Member 11, CDHF11, Epidermal Growth Factor-like Protein 1, EGF-like Protein 1, EGFL1, Flamingo Homolog 1, FMI1, hFmi1, KIAA0812, MEGF2, Multiple Epidermal Growth Factor-like Domains Pr
Product Gene Name
anti-CELSR3 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human CELSR3.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
OMIM
604264
3D Structure
ModBase 3D Structure for Q9NYQ7
Immunogen
Partial recombinant corresponding to aa71-180 from human CELSR3 (NP_001398) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGSRERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH
Conjugate
MaxLight405

Product Categories/Family for anti-CELSR3 antibody

Antibodies; Cadherin
Applications Tested/Suitable for anti-CELSR3 antibody
FLISA, Western Blot (WB)
Application Notes for anti-CELSR3 antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-CELSR3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CELSR3 purchase

MBS6189405 is an antibody targeting CELSR3. Also known as CELSR3 (Cadherin EGF LAG Seven-pass G-type Receptor 3, Cadherin Family Member 11, CDHF11, Epidermal Growth Factor-like Protein 1, EGF-like Protein 1, EGFL1, Flamingo Homolog 1, FMI1, hFmi1, KIAA0812, MEGF2, Multiple Epidermal Growth Factor-like Domains Pr. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CELSR3. It may not necessarily be applicable to this product.

NCBI GI #
145309304
NCBI GeneID
1951
NCBI Accession #
NP_001398
UniProt Primary Accession #
Q9NYQ7
UniProt Related Accession #
Q9NYQ7
GenBank Nucleotide #
NM_001407
NCBI Official Full Name
cadherin EGF LAG seven-pass G-type receptor 3
NCBI Official Synonym Full Names
cadherin EGF LAG seven-pass G-type receptor 3
NCBI Official Symbol
CELSR3
NCBI Official Synonym Symbols
FMI1; EGFL1; HFMI1; MEGF2; ADGRC3; CDHF11; RESDA1
UniProt Protein Name
Cadherin EGF LAG seven-pass G-type receptor 3
UniProt Synonym Protein Names
Cadherin family member 11; Epidermal growth factor-like protein 1; EGF-like protein 1; Flamingo homolog 1; hFmi1; Multiple epidermal growth factor-like domains protein 2
Protein Family
Cadherin EGF LAG seven-pass G-type receptor
UniProt Gene Name
CELSR3
UniProt Synonym Gene Names
CDHF11; EGFL1; FMI1; KIAA0812; MEGF2; EGF-like protein 1; hFmi1
UniProt Entry Name
CELR3_HUMAN
NCBI Protein Information
cadherin EGF LAG seven-pass G-type receptor 3

NCBI Summary for CELSR3

This gene belongs to the flamingo subfamily, which is included in the cadherin superfamily. The flamingo cadherins consist of nonclassic-type cadherins that do not interact with catenins. They are plasma membrane proteins containing seven epidermal growth factor-like repeats, nine cadherin domains and two laminin A G-type repeats in their ectodomain. They also have seven transmembrane domains, a characteristic feature of their subfamily. The encoded protein may be involved in the regulation of contact-dependent neurite growth and may play a role in tumor formation. [provided by RefSeq, Jun 2013]
Show more

UniProt Comments for CELSR3

CELSR3: Receptor that may have an important role in cell/cell signaling during nervous system formation. Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 2

Chromosomal Location of Human Ortholog: 3p21.31

Cellular Component: integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; protein binding; calcium ion binding

Biological Process: G-protein coupled receptor protein signaling pathway; regulation of protein localization; axonal fasciculation; neuron migration; cilium biogenesis; homophilic cell adhesion
Show more

Research Articles on CELSR3

1. CELSR3 copy number variants are associated with Tourette syndrome and implicate cell polarity in pathogenesis.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-CELSR3 antibody

 Products by Pathway  Pathway Diagram
 GPCRs, Other Pathway antibodies  GPCRs, Other Pathway Diagram
 Multifunctional Anion Exchangers Pathway antibodies  Multifunctional Anion Exchangers Pathway Diagram
 SLC-mediated Transmembrane Transport Pathway antibodies  SLC-mediated Transmembrane Transport Pathway Diagram
 Transmembrane Transport Of Small Molecules Pathway antibodies  Transmembrane Transport Of Small Molecules Pathway Diagram
 Transport Of Inorganic Cations/anions And Amino Acids/oligopeptides Pathway antibodies  Transport Of Inorganic Cations/anions And Amino Acids/oligopeptides Pathway Diagram

Diseases associated with anti-CELSR3 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >4 publications with CELSR3 and Neoplasms
 Growth Disorders Antibodies  >2 publications with CELSR3 and Growth Disorders
 Fibrosis Antibodies  >2 publications with CELSR3 and Fibrosis
 Neural Tube Defects Antibodies  >1 publications with CELSR3 and Neural Tube Defects
 Learning Disorders Antibodies  >1 publications with CELSR3 and Learning Disorders
 Brain Diseases Antibodies  >1 publications with CELSR3 and Brain Diseases
 Liver Neoplasms Antibodies  >1 publications with CELSR3 and Liver Neoplasms
 Liver Diseases Antibodies  >1 publications with CELSR3 and Liver Diseases
 Inflammation Antibodies  >1 publications with CELSR3 and Inflammation

Organs/Tissues associated with anti-CELSR3 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >19 publications with CELSR3 and Brain
 Nerve Antibodies  >5 publications with CELSR3 and Nerve
 Embryonic Tissue Antibodies  >5 publications with CELSR3 and Embryonic Tissue
 Eye Antibodies  >3 publications with CELSR3 and Eye
 Lung Antibodies  >3 publications with CELSR3 and Lung
 Skin Antibodies  >2 publications with CELSR3 and Skin
 Testis Antibodies  >1 publications with CELSR3 and Testis
 Intestine Antibodies  >1 publications with CELSR3 and Intestine
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000