Mouse Anti-CREB3L4 Monoclonal Antibody – Cat# MBS6189606

CREB3L4 Antibody – Mouse Monoclonal

Name: CREB3L4 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6189606
Price: 960 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6189606

MBS6189606 is an antibody targeting CREB3L4. Also known as CREB3L4 (AIBZIP, Cyclic AMP-responsive Element-binding Protein 3-like Protein 4, cAMP-responsive Element-binding Protein 3-like Protein 4, Androgen-induced Basic Leucine Zipper Protein, AIbZIP,… More details

$960 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

CREB3L4, Monoclonal Antibody

Full Product Name

CREB3L4 (AIBZIP, Cyclic AMP-responsive Element-binding Protein 3-like Protein 4, cAMP-responsive Element-binding Protein 3-like Protein 4, Androgen-induced Basic Leucine Zipper Protein, AIbZIP, Attaching to CRE-like 1, ATCE1, Cyclic AMP-responsive Element

Product Gene Name

anti-CREB3L4 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

3E3

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human CREB3L4.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

607138

3D Structure

ModBase 3D Structure for Q8TEY5

Immunogen

Partial recombinant protein corresponding to aa1-111 from human CREB3L4 (NP_570968) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGLQESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSP

Conjugate

MaxLight405

Product Categories/Family for anti-CREB3L4 antibody

Antibodies; Binding Proteins

Applications Tested/Suitable for anti-CREB3L4 antibody

FLISA, Immunofluorescence (IF), Western Blot (WB)

Application Notes for anti-CREB3L4 antibody

IF: 10ug/ml
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-CREB3L4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for CREB3L4. It may not necessarily be applicable to this product.

NCBI GI #

18702325

NCBI GeneID

148327

NCBI Accession #

NP_570968

UniProt Primary Accession #

Q8TEY5

UniProt Related Accession #

Q8TEY5

GenBank Nucleotide #

NM_130898

NCBI Official Full Name

cyclic AMP-responsive element-binding protein 3-like protein 4 isoform 1

NCBI Official Synonym Full Names

cAMP responsive element binding protein 3 like 4

NCBI Official Symbol

CREB3L4

NCBI Official Synonym Symbols

JAL; hJAL; ATCE1; CREB3; CREB4; AIBZIP

UniProt Protein Name

Cyclic AMP-responsive element-binding protein 3-like protein 4

UniProt Synonym Protein Names

Androgen-induced basic leucine zipper protein; AIbZIP; Attaching to CRE-like 1; ATCE1; Cyclic AMP-responsive element-binding protein 4; CREB-4; cAMP-responsive element-binding protein 4; Transcript induced in spermiogenesis protein 40; Tisp40; hJALProcessed cyclic AMP-responsive element-binding protein 3-like protein 4

Protein Family

Cyclic AMP-responsive element-binding protein 3-like protein

UniProt Gene Name

CREB3L4

UniProt Synonym Gene Names

AIBZIP; CREB4; JAL; cAMP-responsive element-binding protein 3-like protein 4; AIbZIP; ATCE1; CREB-4; cAMP-responsive element-binding protein 4; Tisp40

UniProt Entry Name

CR3L4_HUMAN

NCBI Protein Information

cyclic AMP-responsive element-binding protein 3-like protein 4

NCBI Summary for CREB3L4

This gene encodes a CREB (cAMP responsive element binding) protein with a transmembrane domain which localizes it to the ER membrane. The encoded protein is a transcriptional activator which contains a dimerization domain, and this protein may function in a number of processing pathways including protein processing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

UniProt Comments for CREB3L4

CREB3L4: Transcriptional activator that may play a role in the unfolded protein response. Binds to the UPR element (UPRE) but not to CRE element. Preferentially binds DNA with to the consensus sequence 5'-T[GT]ACGT[GA][GT]-3' and has transcriptional activation activity from UPRE. Binds to NF-kappa-B site and has transcriptional activation activity from NF-kappa-B-containing regulatory elements. Belongs to the bZIP family. ATF subfamily.

Protein type: Transcription factor; Membrane protein, integral; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane; nucleus

Biological Process: transcription, DNA-dependent; unfolded protein response; positive regulation of transcription from RNA polymerase II promoter; spermatogenesis

Research Articles on CREB3L4

1. Study demonstrated that MCU1 is frequently overexpressed in breast cancer and abnormally high expression of MUC1 indicates poor prognosis. Subsequent data mining across multiple large databases demonstrated a positive association between MUC1 mRNA expression CREB3L4 in breast cancer tissues. Results indicated that MUC1 transcript expression may regulate tumor invasion and metastasis associated with CREB3L4 transcription.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-CREB3L4 antibody

Products by Pathway	Pathway Diagram
AMPK Signaling Pathway antibodies	AMPK Signaling Pathway Diagram
AMPK Signaling Pathway antibodies	AMPK Signaling Pathway Diagram
Adrenergic Signaling In Cardiomyocytes Pathway antibodies	Adrenergic Signaling In Cardiomyocytes Pathway Diagram
Adrenergic Signaling In Cardiomyocytes Pathway antibodies	Adrenergic Signaling In Cardiomyocytes Pathway Diagram
Alcoholism Pathway antibodies	Alcoholism Pathway Diagram
Alcoholism Pathway antibodies	Alcoholism Pathway Diagram
Amphetamine Addiction Pathway antibodies	Amphetamine Addiction Pathway Diagram
Amphetamine Addiction Pathway antibodies	Amphetamine Addiction Pathway Diagram
Cholinergic Synapse Pathway antibodies	Cholinergic Synapse Pathway Diagram
Cocaine Addiction Pathway antibodies	Cocaine Addiction Pathway Diagram

Diseases associated with anti-CREB3L4 antibody

Disease Name	Pubmed Publications
Adenocarcinoma Antibodies	>5 publications with CREB3L4 and Adenocarcinoma
Hyperplasia Antibodies	>2 publications with CREB3L4 and Hyperplasia
Breast Neoplasms Antibodies	>1 publications with CREB3L4 and Breast Neoplasms
Liver Diseases Antibodies	>1 publications with CREB3L4 and Liver Diseases

Organs/Tissues associated with anti-CREB3L4 antibody

Organ/Tissue Name	Pubmed Publications
Prostate Antibodies	>9 publications with CREB3L4 and Prostate
Testis Antibodies	>5 publications with CREB3L4 and Testis
Liver Antibodies	>4 publications with CREB3L4 and Liver
Lung Antibodies	>2 publications with CREB3L4 and Lung
Brain Antibodies	>2 publications with CREB3L4 and Brain
Nerve Antibodies	>2 publications with CREB3L4 and Nerve
Pancreas Antibodies	>2 publications with CREB3L4 and Pancreas
Heart Antibodies	>1 publications with CREB3L4 and Heart
Intestine Antibodies	>1 publications with CREB3L4 and Intestine
Placenta Antibodies	>1 publications with CREB3L4 and Placenta