Mouse Anti-ENO3 Monoclonal Antibody – Cat# MBS6189992

ENO3 Antibody – Mouse Monoclonal

Name: ENO3 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6189992
Price: 960 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6189992

MBS6189992 is an antibody targeting ENO3. Also known as ENO3 (Enolase 3, 2-phospho-D-glycerate Hydro-lyase, beta-Enolase, Muscle-specific Enolase, MSE, Skeletal Muscle Enolase) (MaxLight 405). Reactive in Human. Host: Mouse. More details

$960 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

ENO3, Monoclonal Antibody

Full Product Name

ENO3 (Enolase 3, 2-phospho-D-glycerate Hydro-lyase, beta-Enolase, Muscle-specific Enolase, MSE, Skeletal Muscle Enolase) (MaxLight 405)

Product Gene Name

anti-ENO3 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

5D1

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human ENO3.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

47kDa

OMIM

gene 612932

3D Structure

ModBase 3D Structure for P13929

Immunogen

Partial recombinant corresponding to aa228-277 from human ENO3 (NP_001967) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG

Conjugate

MaxLight405

Product Categories/Family for anti-ENO3 antibody

Antibodies; Enzymes

Applications Tested/Suitable for anti-ENO3 antibody

FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)

Application Notes for anti-ENO3 antibody

IF: 10ug/ml
Applications are based on unconjugated antibody.

Product References and Citations for anti-ENO3 antibody

1. The time course of the adaptations of human muscle proteome to bed rest and the underlying mechanisms. Brocca L, Cannavino J, Coletto L, Biolo G, Sandri M, Bottinelli R, Pellegrino MA.J Physiol. 2012 Aug 6. 2. Functional analysis of beef tenderness. Guillemin N, Bonnet M, Jurie C, Picard B.J Proteomics. 2011 Aug 9. 3. Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. Uys GM, Ramburan A, Loos B, Kinnear CJ, Korkie LJ, Mouton J, Riedemann J, Moolman-Smook JC.BMC Cell Biol. 2011 May 10;12:18. 4. Proteome dynamics during contractile and metabolic differentiation of bovine foetal muscle. Chaze T, Meunier B, Chambon C, Jurie C, Picard B.Animal (2009) doi:10.1017 /S1751731 109004315. 5. Identification of alpha-Enolase as an Autoantigen in Lung Cancer: Its Overexpression Is Associated with Clinical Outcomes. Chang GC, Liu KJ, Hsieh CL, Hu TS, Charoenfuprasert S, Liu HK, Luh KT, Hsu LH, Wu CW, Ting CC, Chen CY, Chen KC, Yang TY, Chou TY, Wang WH, Whang-Peng J, Shih NY.Clin Cancer Res. 2006 Oct 1;12(19):5746-54.

Other Notes

Small volumes of anti-ENO3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for ENO3. It may not necessarily be applicable to this product.

NCBI GI #

301897469

NCBI GeneID

2027

NCBI Accession #

NP_001967

UniProt Primary Accession #

P13929

UniProt Related Accession #

P13929

GenBank Nucleotide #

NM_001976

NCBI Official Full Name

beta-enolase isoform 1

NCBI Official Synonym Full Names

enolase 3

NCBI Official Symbol

ENO3

NCBI Official Synonym Symbols

MSE; GSD13

UniProt Protein Name

Beta-enolase

UniProt Synonym Protein Names

2-phospho-D-glycerate hydro-lyase; Enolase 3; Muscle-specific enolase; MSE; Skeletal muscle enolase

Protein Family

Beta-enolase

UniProt Gene Name

ENO3

UniProt Synonym Gene Names

MSE

UniProt Entry Name

ENOB_HUMAN

NCBI Protein Information

beta-enolase

NCBI Summary for ENO3

This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme is found in skeletal muscle cells in the adult where it may play a role in muscle development and regeneration. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene have be associated glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Jul 2010]

UniProt Comments for ENO3

ENO3: Appears to have a function in striated muscle development and regeneration. Defects in ENO3 are the cause of glycogen storage disease type 13 (GSD13). A metabolic disorder that results in exercise-induced myalgias, generalized muscle weakness and fatigability. It is characterized by increased serum creatine kinase and decreased enolase 3 activity. Dramatically reduced protein levels with focal sarcoplasmic accumulation of glycogen- beta particles are detected on ultrastructural analysis. Belongs to the enolase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Lyase; Carbohydrate Metabolism - glycolysis and gluconeogenesis; EC 4.2.1.11

Chromosomal Location of Human Ortholog: 17p13.2

Cellular Component: extracellular space; phosphopyruvate hydratase complex; cytoplasm; plasma membrane; cytosol

Molecular Function: protein homodimerization activity; protein heterodimerization activity; magnesium ion binding; phosphopyruvate hydratase activity

Biological Process: response to drug; glycolysis; carbohydrate metabolic process; skeletal muscle regeneration; glucose metabolic process; pathogenesis; gluconeogenesis; aging

Disease: Glycogen Storage Disease Xiii

Research Articles on ENO3

1. tRK1 forms a complex with human enolases and interacts with tRK1 and human pre-lysyl-tRNA synthetase (preKARS2)

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.