Mouse Anti-EPHA6 Monoclonal Antibody – Cat# MBS6190007

EPHA6 Antibody – Mouse Monoclonal

Name: EPHA6 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6190007
Price: 960 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6190007

MBS6190007 is an antibody targeting EPHA6. Also known as EPHA6 (Ephrin Type-A Receptor 6, EPH Homology Kinase 2, EHK-2, Ehk-2, Ehk2) (MaxLight 405). Reactive in Human. Host: Mouse. More details

$960 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

EPHA6, Monoclonal Antibody

Full Product Name

EPHA6 (Ephrin Type-A Receptor 6, EPH Homology Kinase 2, EHK-2, Ehk-2, Ehk2) (MaxLight 405)

Product Gene Name

anti-EPHA6 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

2H2

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human EPHA6.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

600066

3D Structure

ModBase 3D Structure for Q9UF33

Immunogen

Partial recombinant protein corresponding to aa613-712 from human EPHA6 (NP_001249) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

PSDTGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDGKFHCCSLKTDP

Conjugate

MaxLight405

Product Categories/Family for anti-EPHA6 antibody

Antibodies; Receptor Tyrosine Kinases

Applications Tested/Suitable for anti-EPHA6 antibody

FLISA, Western Blot (WB)

Application Notes for anti-EPHA6 antibody

Sandwich FLISA: The detection limit is ~3ng/ml as a capture antibody.
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-EPHA6 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for EPHA6. It may not necessarily be applicable to this product.

NCBI GI #

51464077

NCBI Accession #

XP_496653

NCBI Related Accession #

XP_114973

UniProt Primary Accession #

Q9UF33

UniProt Protein Name

Ephrin type-A receptor 6

UniProt Synonym Protein Names

EPH homology kinase 2; EHK-2; EPH-like kinase 12

Protein Family

Ephrin type-A receptor

UniProt Gene Name

EPHA6

UniProt Synonym Gene Names

EHK2; HEK12; EHK-2; EK12

UniProt Entry Name

EPHA6_HUMAN

UniProt Comments for EPHA6

EphA6: Receptor tyrosine kinase which binds promiscuously GPI- anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, TK; Protein kinase, tyrosine (receptor); Kinase, protein; EC 2.7.10.1; Membrane protein, integral; TK group; Eph family

Chromosomal Location of Human Ortholog: 3q11.2

Cellular Component: nucleoplasm; integral to plasma membrane; plasma membrane

Molecular Function: ephrin receptor activity; ATP binding

Biological Process: axon guidance; peptidyl-tyrosine phosphorylation; ephrin receptor signaling pathway

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.