• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

FADS1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6190082

MBS6190082 is an antibody targeting FADS1. Also known as FADS1 (Fatty Acid Desaturase 1, Delta(5) Fatty Acid Desaturase, D5D, Delta(5) Desaturase, Delta-5 Desaturase, FADSD5, FLJ38956, FLJ90273) (MaxLight 405). Reactive in Human. Host: Mouse. More details

$960 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
FADS1, Monoclonal Antibody
Full Product Name
FADS1 (Fatty Acid Desaturase 1, Delta(5) Fatty Acid Desaturase, D5D, Delta(5) Desaturase, Delta-5 Desaturase, FADSD5, FLJ38956, FLJ90273) (MaxLight 405)
Product Gene Name
anti-FADS1 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D9
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human FADS1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
42,474 Da
OMIM
606148
3D Structure
ModBase 3D Structure for O60427
Immunogen
Partial recombinant corresponding to aa1-99 from human FADS1 (NP_037534) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPS
Conjugate
MaxLight405

Product Categories/Family for anti-FADS1 antibody

Antibodies; Enzymes
Applications Tested/Suitable for anti-FADS1 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-FADS1 antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-FADS1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for FADS1. It may not necessarily be applicable to this product.

NCBI GI #
214831730
NCBI GeneID
3992
NCBI Accession #
NP_037534
UniProt Primary Accession #
O60427
UniProt Secondary Accession #
Q53GM5; Q8N3A6; Q8NCC7; Q8NCG0; Q96I39; Q96SV3; Q96T10; Q9NRP8; Q9NYX1; A8K0I7; B2RAI0
UniProt Related Accession #
O60427
GenBank Nucleotide #
NM_013402
NCBI Official Full Name
fatty acid desaturase 1
NCBI Official Synonym Full Names
fatty acid desaturase 1
NCBI Official Symbol
FADS1
NCBI Official Synonym Symbols
D5D; TU12; FADS6; FADSD5; LLCDL1
UniProt Protein Name
Fatty acid desaturase 1
UniProt Synonym Protein Names
Delta(5) fatty acid desaturase; D5D; Delta(5) desaturase; Delta-5 desaturase
Protein Family
Fatty acid desaturase
UniProt Gene Name
FADS1
UniProt Synonym Gene Names
FADSD5; D5D; Delta(5) desaturase; Delta-5 desaturase
UniProt Entry Name
FADS1_HUMAN
NCBI Protein Information
fatty acid desaturase 1; delta(5) desaturase; delta(5) fatty acid desaturase; delta-5 desaturase; delta-5 fatty acid desaturase; linoleoyl-CoA desaturase (delta-6-desaturase)-like 1

UniProt Comments for FADS1

FADS1: Component of a lipid metabolic pathway that catalyzes biosynthesis of highly unsaturated fatty acids (HUFA) from precursor essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Catalyzes the desaturation of dihomo-gamma-linoleic acid (DHGLA) (20:3n-6) and eicosatetraenoic acid (20:4n-3) to generate arachidonic acid (AA) (20:4n-6) and eicosapentaenoic acid (EPA)(20:5n-3) respectively. Belongs to the fatty acid desaturase family.

Protein type: EC 1.14.19.-; Membrane protein, multi-pass; Oxidoreductase; Lipid Metabolism - unsaturated fatty acid biosynthesis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q12.2-q13.1

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle; mitochondrion; membrane; integral to membrane

Molecular Function: C-5 sterol desaturase activity; iron ion binding; heme binding; oxidoreductase activity

Biological Process: icosanoid biosynthetic process; regulation of transcription, DNA-dependent; cell-cell signaling; regulation of cell differentiation; unsaturated fatty acid metabolic process; linoleic acid metabolic process; unsaturated fatty acid biosynthetic process; cellular lipid metabolic process; cellular response to starvation; phospholipid biosynthetic process
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-FADS1 antibody

 Products by Pathway  Pathway Diagram
 Biosynthesis Of Unsaturated Fatty Acids Pathway antibodies  Biosynthesis Of Unsaturated Fatty Acids Pathway Diagram
 Biosynthesis Of Unsaturated Fatty Acids Pathway antibodies  Biosynthesis Of Unsaturated Fatty Acids Pathway Diagram
 Fatty Acid Metabolism Pathway antibodies  Fatty Acid Metabolism Pathway Diagram
 Fatty Acid Metabolism Pathway antibodies  Fatty Acid Metabolism Pathway Diagram
 Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway antibodies  Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway Diagram
 Linoleic Acid (LA) Metabolism Pathway antibodies  Linoleic Acid (LA) Metabolism Pathway Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 Metabolism Of Lipids And Lipoproteins Pathway antibodies  Metabolism Of Lipids And Lipoproteins Pathway Diagram
 PPARA Activates Gene Expression Pathway antibodies  PPARA Activates Gene Expression Pathway Diagram
 Regulation Of Lipid Metabolism By Peroxisome Proliferator-activated Receptor Alpha (PPARalpha) Pathway antibodies  Regulation Of Lipid Metabolism By Peroxisome Proliferator-activated Receptor Alpha (PPARalpha) Pathway Diagram

Diseases associated with anti-FADS1 antibody

 Disease Name  Pubmed Publications
 Fatty Liver Antibodies  >24 publications with FADS1 and Fatty Liver
 Cardiovascular Diseases Antibodies  >23 publications with FADS1 and Cardiovascular Diseases
 Inflammation Antibodies  >22 publications with FADS1 and Inflammation
 Heart Diseases Antibodies  >11 publications with FADS1 and Heart Diseases
 Hypertension Antibodies  >7 publications with FADS1 and Hypertension
 Hyperglycemia Antibodies  >6 publications with FADS1 and Hyperglycemia
 Liver Diseases Antibodies  >5 publications with FADS1 and Liver Diseases
 Atherosclerosis Antibodies  >4 publications with FADS1 and Atherosclerosis
 Disease Models, Animal Antibodies  >4 publications with FADS1 and Disease Models, Animal
 Depressive Disorder Antibodies  >3 publications with FADS1 and Depressive Disorder

Organs/Tissues associated with anti-FADS1 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >84 publications with FADS1 and Blood
 Liver Antibodies  >31 publications with FADS1 and Liver
 Heart Antibodies  >17 publications with FADS1 and Heart
 Adipose Tissue Antibodies  >13 publications with FADS1 and Adipose Tissue
 Brain Antibodies  >11 publications with FADS1 and Brain
 Muscle Antibodies  >9 publications with FADS1 and Muscle
 Connective Tissue Antibodies  >9 publications with FADS1 and Connective Tissue
 Vascular Antibodies  >4 publications with FADS1 and Vascular
 Prostate Antibodies  >3 publications with FADS1 and Prostate
 Eye Antibodies  >3 publications with FADS1 and Eye
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000