Mouse Anti-GAS2 Monoclonal Antibody – Cat# MBS6190434

Growth Arrest Specific 2 (GAS2) Antibody – Mouse Monoclonal

Name: GAS2 Antibody; Monoclonal; Mouse; Human/Mouse-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6190434
Price: 960 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6190434

MBS6190434 is an antibody targeting GAS2. Also known as Growth Arrest Specific 2 (Growth Arrest-specific Protein 2, GAS2, GAS-2, MGC32610) (MaxLight 405). Reactive in Human, Mouse. Host: Mouse. More details

$960 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

Growth Arrest Specific 2 (GAS2), Monoclonal Antibody

Full Product Name

Growth Arrest Specific 2 (Growth Arrest-specific Protein 2, GAS2, GAS-2, MGC32610) (MaxLight 405)

Product Gene Name

anti-GAS2 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

4E11

Host

Mouse

Species Reactivity

Human, Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human GAS2. Species Crossreactivity: mouse.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

602835

3D Structure

ModBase 3D Structure for O43903

Immunogen

Partial recombinant corresponding to aa1-110 from human GAS2 (NP_005247) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFAR

Conjugate

MaxLight405

Product Categories/Family for anti-GAS2 antibody

Antibodies; Apoptosis

Applications Tested/Suitable for anti-GAS2 antibody

FLISA, Immunofluorescence (IF), Western Blot (WB)

Application Notes for anti-GAS2 antibody

IF: 10ug/ml
Applications are based on unconjugated antibody.

Product References and Citations for anti-GAS2 antibody

1. p53-dependent translational control of senescence and transformation via 4E-BPs. Petroulakis E, Parsyan A, Dowling RJ, LeBacquer O, Martineau Y, Bidinosti M, Larsson O, Alain T, Rong L, Mamane Y, Paquet M, Furic L, Topisirovic I, Shahbazian D, Livingstone M, Costa-Mattioli M, Teodoro JG, Sonenberg N.Cancer Cell. 2009 Nov 6;16(5):439-46.

Other Notes

Small volumes of anti-GAS2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for GAS2. It may not necessarily be applicable to this product.

NCBI GI #

4885253

NCBI GeneID

2620

NCBI Accession #

NP_005247

UniProt Primary Accession #

O43903

UniProt Related Accession #

O43903

GenBank Nucleotide #

NM_005256

NCBI Official Full Name

growth arrest-specific protein 2 isoform a

NCBI Official Synonym Full Names

growth arrest specific 2

NCBI Official Symbol

GAS2

NCBI Official Synonym Symbols

GAS-2

UniProt Protein Name

Growth arrest-specific protein 2

Protein Family

1,3-beta-glucanosyltransferase

UniProt Gene Name

GAS2

UniProt Synonym Gene Names

GAS-2

UniProt Entry Name

GAS2_HUMAN

NCBI Protein Information

growth arrest-specific protein 2

NCBI Summary for GAS2

The protein encoded by this gene is a caspase-3 substrate that plays a role in regulating microfilament and cell shape changes during apoptosis. It can also modulate cell susceptibility to p53-dependent apoptosis by inhibiting calpain activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2017]

UniProt Comments for GAS2

GAS2: May play a role in apoptosis by acting as a cell death substrate for caspases. Is cleaved during apoptosis and the cleaved form induces dramatic rearrangements of the actin cytoskeleton and potent changes in the shape of the affected cells. May be involved in the membrane ruffling process. Belongs to the GAS2 family.

Protein type: Motility/polarity/chemotaxis; Apoptosis

Chromosomal Location of Human Ortholog: 11p14.3

Cellular Component: membrane; actin filament; cytosol

Biological Process: regulation of cell shape; apoptosis; cell cycle arrest; cell structure disassembly during apoptosis

Research Articles on GAS2

1. GAS2 protein expression was lower in hepatocellular carcinoma (HCC) than in normal tissues. Overexpression of GAS2 inhibited the proliferation of HCC cells with wide type p53, while knockdown of GAS2 promoted the proliferation of hepatocytes. Results suggest that GAS2 plays a vital role in HCC cell proliferation and apoptosis, possibly by regulating the cell cycle and p53-dependent apoptosis pathway.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.