Mouse Anti-NETO2 Monoclonal Antibody – Cat# MBS6191409

NETO2 Antibody – Mouse Monoclonal

Name: NETO2 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6191409
Price: 960 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6191409

This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential… More details

$960 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

NETO2, Monoclonal Antibody

Full Product Name

NETO2 (BTCL2, Neuropilin and Tolloid-like Protein 2, Brain-specific Transmembrane Protein Containing 2 CUB and 1 LDL-receptor Class A Domains Protein 2, FLJ10430, FLJ14724, FLJ90456, NEOT2) (MaxLight 405)

Product Gene Name

anti-NETO2 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

3E3

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human NETO2.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

607974

3D Structure

ModBase 3D Structure for Q8NC67

Immunogen

Partial recombinant corresponding to aa426-526 from human NETO2 (NP_060562) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

RRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF

Conjugate

MaxLight405

Product Categories/Family for anti-NETO2 antibody

Antibodies; Neuroscience

Applications Tested/Suitable for anti-NETO2 antibody

FLISA, Western Blot (WB)

Application Notes for anti-NETO2 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-NETO2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for NETO2 purchase

MBS6191409 is an antibody targeting NETO2. Also known as NETO2 (BTCL2, Neuropilin and Tolloid-like Protein 2, Brain-specific Transmembrane Protein Containing 2 CUB and 1 LDL-receptor Class A Domains Protein 2, FLJ10430, FLJ14724, FLJ90456, NEOT2) (MaxLight 405). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for NETO2. It may not necessarily be applicable to this product.

NCBI GI #

24041026

NCBI Accession #

NP_060562.3

UniProt Primary Accession #

Q8NC67

GenBank Nucleotide #

NM_018092

NCBI Official Full Name

neuropilin and tolloid-like protein 2 isoform 1

UniProt Protein Name

Neuropilin and tolloid-like protein 2

UniProt Synonym Protein Names

Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2

Protein Family

Neuropilin and tolloid-like protein

UniProt Gene Name

NETO2

UniProt Synonym Gene Names

BTCL2

UniProt Entry Name

NETO2_HUMAN

UniProt Comments for NETO2

NETO2: Accessory subunit of neuronal kainate-sensitive glutamate receptors, GRIK2 and GRIK3. Increases kainate-receptor channel activity, slowing the decay kinetics of the receptors, without affecting their expression at the cell surface, and increasing the open probability of the receptor channels. Modulates the agonist sensitivity of kainate receptors. Slows the decay of kainate receptor-mediated excitatory postsynaptic currents (EPSCs), thus directly influencing synaptic transmission. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 16q11

Cellular Component: kainate selective glutamate receptor complex; postsynaptic density

Molecular Function: ionotropic glutamate receptor binding

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.