Mouse Anti-SENP6 Monoclonal Antibody – Cat# MBS6192529

SENP6 Antibody – Mouse Monoclonal

Name: SENP6 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6192529
Price: 960 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6192529

MBS6192529 is an antibody targeting SENP6. Also known as SENP6 (Sentrin-specific Protease 6, Sentrin/SUMO-specific Protease SENP6, FKSG6, KIAA0797, SUMO-1-specific Protease 1, SSP1, SUSP1) (MaxLight 405). Reactive in Human. Host: Mouse. More details

$960 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

SENP6, Monoclonal Antibody

Full Product Name

SENP6 (Sentrin-specific Protease 6, Sentrin/SUMO-specific Protease SENP6, FKSG6, KIAA0797, SUMO-1-specific Protease 1, SSP1, SUSP1) (MaxLight 405)

Product Gene Name

anti-SENP6 antibody

Product Synonym Names

EC=3.4.22.68

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

4B7

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human SENP6.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

605003

3D Structure

ModBase 3D Structure for Q9GZR1

Immunogen

Partial recombinant corresponding to aa1-111 from human SENP6 (NP_056386) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MAAGKSGGSAGEITFLEALARSESKRDGGFKNNWSFDHEEESEGDTDKDGTNLLSVDEDEDSETSKGKKLNRRSEIVANSSGEFILKTYVRRNKSESFKTLKGNPIGLNM*

Conjugate

MaxLight405

Product Categories/Family for anti-SENP6 antibody

Antibodies; Ubiquitin

Applications Tested/Suitable for anti-SENP6 antibody

FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)

Application Notes for anti-SENP6 antibody

IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Product References and Citations for anti-SENP6 antibody

1. Regulation of DNA repair through deSUMOylation and SUMOylation of replication protein A complex. Dou H, Huang C, Singh M, Carpenter PB, Yeh ET.Mol Cell. 2010 Aug 13;39(3):333-45. 2. SENP3-mediated de-conjugation of SUMO2/3 from promyelocytic leukemia is correlated with accelerated cell proliferation under mild oxidative stress. Han Y, Huang C, Sun X, Xiang B, Wang M, Yeh ET, Chen Y, Li H, Shi G, Cang H, Sun Y, Wang J, Wang W, Gao F, Yi J.J Biol Chem. 2010 Apr 23;285(17):12906-15. Epub 2010 Feb 24.

Other Notes

Small volumes of anti-SENP6 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for SENP6. It may not necessarily be applicable to this product.

NCBI GI #

156105701

NCBI Accession #

NP_056386

UniProt Primary Accession #

Q9GZR1

GenBank Nucleotide #

NM_015571

NCBI Official Full Name

sentrin-specific protease 6 isoform 1

UniProt Protein Name

Sentrin-specific protease 6

UniProt Synonym Protein Names

SUMO-1-specific protease 1; Sentrin/SUMO-specific protease SENP6

Protein Family

Sentrin-specific protease

UniProt Gene Name

SENP6

UniProt Synonym Gene Names

KIAA0797; SSP1; SUSP1

UniProt Entry Name

SENP6_HUMAN

UniProt Comments for SENP6

SENP6: Protease that deconjugates SUMO1, SUMO2 and SUMO3 from targeted proteins. Processes preferentially poly-SUMO2 and poly- SUMO3 chains, but does not efficiently process SUMO1, SUMO2 and SUMO3 precursors. Deconjugates SUMO1 from RXRA, leading to transcriptional activation. Involved in chromosome alignment and spindle assembly, by regulating the kinetochore CENPH-CENPI-CENPK complex. Desumoylates PML and CENPI, protecting them from degradation by the ubiquitin ligase RNF4, which targets polysumoylated proteins for proteasomal degradation. Desumoylates also RPA1, thus preventing recruitment of RAD51 to the DNA damage foci to initiate DNA repair through homologous recombination. Belongs to the peptidase C48 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; EC 3.4.22.68

Chromosomal Location of Human Ortholog: 6q14.1

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: protein binding; SUMO-specific protease activity

Biological Process: protein desumoylation; protein sumoylation; proteolysis

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-SENP6 antibody

Disease Name	Pubmed Publications
Liver Diseases Antibodies	>2 publications with SENP6 and Liver Diseases
Carcinoma, Hepatocellular Antibodies	>2 publications with SENP6 and Carcinoma, Hepatocellular
Adenocarcinoma Antibodies	>2 publications with SENP6 and Adenocarcinoma
Liver Neoplasms Antibodies	>2 publications with SENP6 and Liver Neoplasms
Neoplasms, Experimental Antibodies	>2 publications with SENP6 and Neoplasms, Experimental
Ataxia Antibodies	>1 publications with SENP6 and Ataxia
Anemia Antibodies	>1 publications with SENP6 and Anemia
Inflammation Antibodies	>1 publications with SENP6 and Inflammation
Necrosis Antibodies	>1 publications with SENP6 and Necrosis
Weight Loss Antibodies	>1 publications with SENP6 and Weight Loss

Organs/Tissues associated with anti-SENP6 antibody

Organ/Tissue Name	Pubmed Publications
Liver Antibodies	>3 publications with SENP6 and Liver
Testis Antibodies	>3 publications with SENP6 and Testis
Prostate Antibodies	>2 publications with SENP6 and Prostate
Blood Antibodies	>2 publications with SENP6 and Blood
Bone Antibodies	>2 publications with SENP6 and Bone
Heart Antibodies	>2 publications with SENP6 and Heart
Brain Antibodies	>2 publications with SENP6 and Brain
Kidney Antibodies	>1 publications with SENP6 and Kidney
Skin Antibodies	>1 publications with SENP6 and Skin
Vascular Antibodies	>1 publications with SENP6 and Vascular