Mouse Anti-SLURP1 Monoclonal Antibody – Cat# MBS6192718

SLURP1 Antibody – Mouse Monoclonal

Name: SLURP1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6192718
Price: 960 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6192718

MaxLight405 is a new Violet photostable dye conjugate comparable to Alexa Fluor 405, PacificBlue, Brilliant Violet 421 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (400nm); Emission (423nm); Extinction… More details

$960 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

SLURP1, Monoclonal Antibody

Full Product Name

SLURP1 (Secreted Ly-6/uPAR-related Protein 1, SLURP-1, Anti-neoplastic Urinary Protein, ANUP, ARS Component B, ArsB, ARS(component B)-81/S, ARS, LY6LS, MDM) (MaxLight 405)

Product Gene Name

anti-SLURP1 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

4D1

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human SLURP1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

248300

3D Structure

ModBase 3D Structure for P55000

Immunogen

Partial recombinant corresponding to aa25-103 from human SLURP1 (NP_065160) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

CYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSE

Conjugate

MaxLight405

Product Categories/Family for anti-SLURP1 antibody

Antibodies; Proteins

Applications Tested/Suitable for anti-SLURP1 antibody

FLISA, Immunoprecipitation (IP), Western Blot (WB)

Application Notes for anti-SLURP1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-SLURP1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SLURP1 purchase

MBS6192718 is an antibody targeting SLURP1. Also known as SLURP1 (Secreted Ly-6/uPAR-related Protein 1, SLURP-1, Anti-neoplastic Urinary Protein, ANUP, ARS Component B, ArsB, ARS(component B)-81/S, ARS, LY6LS, MDM) (MaxLight 405). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for SLURP1. It may not necessarily be applicable to this product.

NCBI GI #

9966907

NCBI Accession #

NP_065160

UniProt Primary Accession #

P55000

GenBank Nucleotide #

NM_020427

NCBI Official Full Name

secreted Ly-6/uPAR-related protein 1

UniProt Protein Name

Secreted Ly-6/uPAR-related protein 1

UniProt Synonym Protein Names

ARS component B; ARS(component B)-81/S; Anti-neoplastic urinary protein

Protein Family

Secreted Ly-6/uPAR-related protein

UniProt Gene Name

SLURP1

UniProt Synonym Gene Names

ARS; SLURP-1; ANUP

UniProt Entry Name

SLUR1_HUMAN

UniProt Comments for SLURP1

SLURP1: Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin. Defects in SLURP1 are a cause of Mal de Meleda (MDM); also known as keratosis palmoplantaris transgradiens of Siemens. MDM is a rare autosomal recessive skin disorder, characterized by diffuse transgressive palmoplantar keratoderma with keratotic lesions extending onto the dorsa of the hands and the feet (transgrediens). Patients may have hyperhidrosis. Other features include perioral erythema, lichenoid plaques on the knees and the elbows, and nail abnormalities.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: extracellular space; extracellular region

Molecular Function: cytokine activity

Biological Process: neuromuscular process controlling posture; cell activation; locomotory behavior; cell adhesion

Disease: Mal De Meleda

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-SLURP1 antibody

Disease Name	Pubmed Publications
Keratoderma, Palmoplantar Antibodies	>36 publications with SLURP1 and Keratoderma, Palmoplantar
Disease Models, Animal Antibodies	>3 publications with SLURP1 and Disease Models, Animal
Intestinal Neoplasms Antibodies	>3 publications with SLURP1 and Intestinal Neoplasms
Necrosis Antibodies	>3 publications with SLURP1 and Necrosis
Pain Antibodies	>2 publications with SLURP1 and Pain
Neoplasms, Experimental Antibodies	>2 publications with SLURP1 and Neoplasms, Experimental

Organs/Tissues associated with anti-SLURP1 antibody

Organ/Tissue Name	Pubmed Publications
Eye Antibodies	>5 publications with SLURP1 and Eye