• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

SMG1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6197956

This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein.… More details

$960 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
SMG1, Monoclonal Antibody
Full Product Name
SMG1 (SMG1 Homolog, Phosphatidylinositol 3-Kinase-Related Kinase (C. elegans), 61E3.4, ATX, KIAA0421, LIP) (MaxLight 405)
Product Gene Name
anti-SMG1 antibody
Product Synonym Names
SMG1 Homolog; Phosphatidylinositol 3-Kinase-Related Kinase (C. elegans); 61E3.4; ATX; KIAA0421; LIP
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B10
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Purity/Purification
Purified
Specificity
Recognizes SMG1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
138,996 Da
3D Structure
ModBase 3D Structure for Q9H2G2
Immunogen
SMG1 (NP_055535, 2922aa-3031aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV
Conjugate
MaxLight405

Product Categories/Family for anti-SMG1 antibody

Antibodies; Protein Kinases
Applications Tested/Suitable for anti-SMG1 antibody
Western Blot (WB)
Application Notes for anti-SMG1 antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-SMG1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SMG1 purchase

MBS6197956 is an antibody targeting SMG1. Also known as SMG1 (SMG1 Homolog, Phosphatidylinositol 3-Kinase-Related Kinase (C. elegans), 61E3.4, ATX, KIAA0421, LIP) (MaxLight 405). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for SMG1. It may not necessarily be applicable to this product.

NCBI GI #
41281453
NCBI GeneID
9748
NCBI Accession #
NP_055535
UniProt Primary Accession #
Q9H2G2
UniProt Secondary Accession #
O00211; Q6P1Z4; Q86WU7; Q86WW1; Q92603; Q9NQL0; Q9NQL1; D3DRA0; D3DRA1
UniProt Related Accession #
Q9H2G2
GenBank Nucleotide #
NM_014720
NCBI Official Full Name
STE20-like serine/threonine-protein kinase isoform 1
NCBI Official Synonym Full Names
STE20-like kinase
NCBI Official Symbol
SLK
NCBI Official Synonym Symbols
LOSK; STK2; se20-9; bA16H23.1
UniProt Protein Name
STE20-like serine/threonine-protein kinase
UniProt Synonym Protein Names
CTCL tumor antigen se20-9; STE20-related serine/threonine-protein kinase; STE20-related kinase; Serine/threonine-protein kinase 2
Protein Family
Probable serine/threonine-protein kinase
UniProt Gene Name
SLK
UniProt Synonym Gene Names
KIAA0204; STK2; STE20-like kinase; hSLK
UniProt Entry Name
SLK_HUMAN
NCBI Protein Information
STE20-like serine/threonine-protein kinase; CTCL tumor antigen se20-9; Long Ste20-like Kinase; SNF1 (sucrose nonfermenting, yeast, homolog)-like kinase, SNF1 sucrose nonfermenting like kinase; STE20-related kinase; STE20-related serine/threonine-protein k

UniProt Comments for SMG1

SLK: a microtubule-associated protein kinase required for progression through G2. Co-localizes with the mitotic spindle in cells undergoing mitosis. Regulates actin reorganization during cell adhesion and spreading via a Rac1-mediated pathway. Signals via ASK1 and p38 to promote apoptosis. Activated in response to anoxia and ischemia-reperfusion injury in cell culture. It inhibits the protective aspects of the endoplasmic reticulum stress response, thus contributing to its proapoptotic effect. Two alternatively-spliced isoforms have been described.

Protein type: Protein kinase, STE; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; STE group; STE20 family; SLK subfamily

Chromosomal Location of Human Ortholog: 10q24.33

Cellular Component: cytoplasm

Molecular Function: protein serine/threonine kinase activity; identical protein binding; protein homodimerization activity; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: apoptosis; protein amino acid autophosphorylation
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-SMG1 antibody

 Reference Product  PubMed Publications
 CLSTN1 antibody  >1 publications with SMG1 and CLSTN1
 CASP3 antibody  >1 publications with SMG1 and CASP3

Pathways associated with anti-SMG1 antibody

 Products by Pathway  Pathway Diagram
 Oocyte Meiosis Pathway antibodies  Oocyte Meiosis Pathway Diagram
 Oocyte Meiosis Pathway antibodies  Oocyte Meiosis Pathway Diagram

Diseases associated with anti-SMG1 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >65 publications with SMG1 and Neoplasms
 Kidney Diseases Antibodies  >25 publications with SMG1 and Kidney Diseases
 Cardiovascular Diseases Antibodies  >24 publications with SMG1 and Cardiovascular Diseases
 Genital Diseases, Male Antibodies  >21 publications with SMG1 and Genital Diseases, Male
 Liver Diseases Antibodies  >16 publications with SMG1 and Liver Diseases
 Inflammation Antibodies  >12 publications with SMG1 and Inflammation
 Kidney Neoplasms Antibodies  >10 publications with SMG1 and Kidney Neoplasms
 Nervous System Diseases Antibodies  >10 publications with SMG1 and Nervous System Diseases
 Acute Kidney Injury Antibodies  >7 publications with SMG1 and Acute Kidney Injury
 Hepatitis Antibodies  >7 publications with SMG1 and Hepatitis

Organs/Tissues associated with anti-SMG1 antibody

 Organ/Tissue Name  Pubmed Publications
 Kidney Antibodies  >53 publications with SMG1 and Kidney
 Blood Antibodies  >46 publications with SMG1 and Blood
 Eye Antibodies  >32 publications with SMG1 and Eye
 Liver Antibodies  >31 publications with SMG1 and Liver
 Prostate Antibodies  >25 publications with SMG1 and Prostate
 Vascular Antibodies  >18 publications with SMG1 and Vascular
 Nerve Antibodies  >15 publications with SMG1 and Nerve
 Bladder Antibodies  >14 publications with SMG1 and Bladder
 Brain Antibodies  >12 publications with SMG1 and Brain
 Lymph Antibodies  >10 publications with SMG1 and Lymph
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000