• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

BCL11A Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6199736

MBS6199736 is an antibody targeting BCL11A. Also known as BCL11A (CTIP1, EVI9, KIAA1809, ZNF856, B Cell Lymphoma/Leukemia 11A, B Cell CLL/Lymphoma 11A, COUP-TF-interacting Protein 1, Ecotropic Viral Integration Site 9 Protein Homolog, Zinc Finger Protein 856,… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
BCL11A, Monoclonal Antibody
Full Product Name
BCL11A (CTIP1, EVI9, KIAA1809, ZNF856, B Cell Lymphoma/Leukemia 11A, B Cell CLL/Lymphoma 11A, COUP-TF-interacting Protein 1, Ecotropic Viral Integration Site 9 Protein Homolog, Zinc Finger Protein 856, FLJ10173, FLJ34997, HBFQTL5) (MaxLight 490)
Product Gene Name
anti-BCL11A antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D9
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human BCL11A.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
87,554 Da
OMIM
142335
3D Structure
ModBase 3D Structure for Q9H165
Immunogen
Partial recombinant corresponding to aa1-89 from human BCL11A (NP_060484) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS
Conjugate
MaxLight490

Product Categories/Family for anti-BCL11A antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger
Applications Tested/Suitable for anti-BCL11A antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-BCL11A antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-BCL11A antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for BCL11A. It may not necessarily be applicable to this product.

NCBI GI #
20336307
NCBI GeneID
53335
NCBI Accession #
NP_060484
UniProt Primary Accession #
Q9H165
UniProt Secondary Accession #
Q86W14; Q8WU92; Q96JL6; Q9H163; Q9H164; Q9H3G9; Q9NWA7; D6W5D7
UniProt Related Accession #
Q9H165
GenBank Nucleotide #
NM_018014
NCBI Official Full Name
B-cell lymphoma/leukemia 11A isoform 2
NCBI Official Synonym Full Names
B-cell CLL/lymphoma 11A (zinc finger protein)
NCBI Official Symbol
BCL11A
NCBI Official Synonym Symbols
EVI9; CTIP1; ZNF856; HBFQTL5; BCL11A-L; BCL11A-S; BCL11a-M; BCL11A-XL
UniProt Protein Name
B-cell lymphoma/leukemia 11A
UniProt Synonym Protein Names
B-cell CLL/lymphoma 11A; COUP-TF-interacting protein 1; Ecotropic viral integration site 9 protein homolog; EVI-9; Zinc finger protein 856
Protein Family
B-cell lymphoma/leukemia
UniProt Gene Name
BCL11A
UniProt Synonym Gene Names
CTIP1; EVI9; KIAA1809; ZNF856; BCL-11A; EVI-9
UniProt Entry Name
BC11A_HUMAN
NCBI Protein Information
B-cell lymphoma/leukemia 11A; B-cell CLL/lymphoma 11A (zinc finger protein) isoform 2; BCL-11A; BCL11A B-cell CLL/lymphoma 11A (zinc finger protein) isoform 1; C2H2-type zinc finger protein; COUP-TF-interacting protein 1; EVI-9; ecotropic viral integratio

UniProt Comments for BCL11A

Bcl-11A: Functions as a myeloid and B-cell proto-oncogene. May play important roles in leukemogenesis and hematopoiesis. An essential factor in lymphopoiesis, is required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1. Chromosomal aberrations involving BCL11A may be a cause of lymphoid malignancies. Translocation t(2;14)(p13;q32.3) causes BCL11A deregulation and amplification. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; C2H2-type zinc finger protein; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 2p16.1

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein homodimerization activity; protein heterodimerization activity; metal ion binding; transcription corepressor activity

Biological Process: protein sumoylation; transcription, DNA-dependent; B cell differentiation; regulation of dendrite development; positive regulation of transcription from RNA polymerase II promoter; negative regulation of collateral sprouting; negative regulation of transcription from RNA polymerase II promoter; negative regulation of axon extension; positive regulation of collateral sprouting; negative regulation of protein homooligomerization; T cell differentiation
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-BCL11A antibody

 Reference Product  PubMed Publications
 HBS1L antibody  >28 publications with BCL11A and HBS1L
 HBG2 antibody  >11 publications with BCL11A and HBG2
 SOX6 antibody  >6 publications with BCL11A and SOX6
 SIRT1 antibody  >2 publications with BCL11A and SIRT1
 NR2E1 antibody  >2 publications with BCL11A and NR2E1
 HDAC1 antibody  >1 publications with BCL11A and HDAC1
 NR2F1 antibody  >1 publications with BCL11A and NR2F1
 NR2F2 antibody  >1 publications with BCL11A and NR2F2

Organs/Tissues associated with anti-BCL11A antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >86 publications with BCL11A and Blood
 Brain Antibodies  >11 publications with BCL11A and Brain
 Heart Antibodies  >6 publications with BCL11A and Heart
 Lymph Node Antibodies  >6 publications with BCL11A and Lymph Node
 Embryonic Tissue Antibodies  >5 publications with BCL11A and Embryonic Tissue
 Lymph Antibodies  >5 publications with BCL11A and Lymph
 Thymus Antibodies  >4 publications with BCL11A and Thymus
 Skin Antibodies  >4 publications with BCL11A and Skin
 Lung Antibodies  >4 publications with BCL11A and Lung
 Kidney Antibodies  >4 publications with BCL11A and Kidney
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000