• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

CACNG7 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6199857

MaxLight490 is a new Blue-Green photostable dye conjugate comparable to DyLight488, Alexa Fluor488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
CACNG7, Monoclonal Antibody
Full Product Name
CACNG7 (Voltage-dependent Calcium Channel gamma-7 Subunit, Neuronal Voltage-gated Calcium Channel gamma-7 Subunit, Transmembrane AMPAR Regulatory Protein gamma-7) (MaxLight 490)
Product Gene Name
anti-CACNG7 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human CACNG7.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
31,003 Da
Chromosome Location
Chromosome: 19; NC_000019.9 (54415991..54446969). Location: 19q13.4
OMIM
606899
3D Structure
ModBase 3D Structure for P62955
Immunogen
Partial recombinant corresponding to aa203-275 from human CACNG7 (NP_114102) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSP
Conjugate
MaxLight490

Product Categories/Family for anti-CACNG7 antibody

Antibodies; Ion Channel
Applications Tested/Suitable for anti-CACNG7 antibody
FLISA, Western Blot (WB)
Application Notes for anti-CACNG7 antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-CACNG7 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CACNG7 purchase

MBS6199857 is an antibody targeting CACNG7. Also known as CACNG7 (Voltage-dependent Calcium Channel gamma-7 Subunit, Neuronal Voltage-gated Calcium Channel gamma-7 Subunit, Transmembrane AMPAR Regulatory Protein gamma-7) (MaxLight 490). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CACNG7. It may not necessarily be applicable to this product.

NCBI GI #
21361975
NCBI GeneID
59284
NCBI Accession #
NP_114102.2
UniProt Primary Accession #
P62955
UniProt Secondary Accession #
Q52LL8; Q8VBX3; Q8WXS6; Q9BXT1
UniProt Related Accession #
P62955
GenBank Nucleotide #
NM_031896
NCBI Official Full Name
voltage-dependent calcium channel gamma-7 subunit
NCBI Official Synonym Full Names
calcium channel, voltage-dependent, gamma subunit 7
NCBI Official Symbol
CACNG7
UniProt Protein Name
Voltage-dependent calcium channel gamma-7 subunit
UniProt Synonym Protein Names
Neuronal voltage-gated calcium channel gamma-7 subunit; Transmembrane AMPAR regulatory protein gamma-7
Protein Family
Voltage-dependent calcium channel
UniProt Gene Name
CACNG7
UniProt Synonym Gene Names
TARP gamma-7
UniProt Entry Name
CCG7_HUMAN
NCBI Protein Information
voltage-dependent calcium channel gamma-7 subunit; TARP gamma-7; transmembrane AMPAR regulatory protein gamma-7; neuronal voltage-gated calcium channel gamma-7 subunit

NCBI Summary for CACNG7

The protein encoded by this gene is a type II transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members, a type I TARP and a calcium channel gamma subunit. [provided by RefSeq, Dec 2010]
Show more

UniProt Comments for CACNG7

CACNG7: Regulates the trafficking and gating properties of AMPA- selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization. Displays subunit-specific AMPA receptor regulation. Shows specificity only for GRIA1 and GRIA2. Thought to stabilize the calcium channel in an inactivated (closed) state. Belongs to the PMP-22/EMP/MP20 family. CACNG subfamily.

Protein type: Channel, calcium; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: voltage-gated calcium channel complex

Molecular Function: voltage-gated calcium channel activity

Biological Process: calcium ion transport
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-CACNG7 antibody

 Products by Pathway  Pathway Diagram
 Arrhythmogenic Right Ventricular Cardiomyopathy Pathway antibodies  Arrhythmogenic Right Ventricular Cardiomyopathy Pathway Diagram
 Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway antibodies  Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway Diagram
 Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway antibodies  Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway Diagram
 Cardiac Muscle Contraction Pathway antibodies  Cardiac Muscle Contraction Pathway Diagram
 Cardiac Muscle Contraction Pathway antibodies  Cardiac Muscle Contraction Pathway Diagram
 Dilated Cardiomyopathy Pathway antibodies  Dilated Cardiomyopathy Pathway Diagram
 Dilated Cardiomyopathy Pathway antibodies  Dilated Cardiomyopathy Pathway Diagram
 Hypertrophic Cardiomyopathy (HCM) Pathway antibodies  Hypertrophic Cardiomyopathy (HCM) Pathway Diagram
 Hypertrophic Cardiomyopathy (HCM) Pathway antibodies  Hypertrophic Cardiomyopathy (HCM) Pathway Diagram
 MAPK Signaling Pathway antibodies  MAPK Signaling Pathway Diagram

Diseases associated with anti-CACNG7 antibody

 Disease Name  Pubmed Publications
 Cardiovascular Diseases Antibodies  >1 publications with CACNG7 and Cardiovascular Diseases

Organs/Tissues associated with anti-CACNG7 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >2 publications with CACNG7 and Brain
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000